PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc11_g13270
Common NameGSCOC_T00032203001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family bHLH
Protein Properties Length: 93aa    MW: 10474.8 Da    PI: 9.362
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc11_g13270genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH26.61.1e-0819591454
                 HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
          HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                 d+i +   +L++l+P++ + +s K+s + +L+++++YI+sL
  Cc11_g13270 19 DQIADLVTKLQQLIPELRRRRSDKVSASKVLQETCNYIRSL 59
                 67889999********889********************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.280.103.9E-9376IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088810.512559IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474592.75E-91977IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000102.6E-61959IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 93 aa     Download sequence    Send to blast
MSSRRSRSRQ SGASRITDDQ IADLVTKLQQ LIPELRRRRS DKVSASKVLQ ETCNYIRSLH  60
REVDDLSDRL SELLESTDSD SAQAAIIRSL LM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011075476.12e-45PREDICTED: transcription factor PRE6
SwissprotQ8GW323e-41PRE6_ARATH; Transcription factor PRE6
SwissprotQ9LJX13e-41PRE5_ARATH; Transcription factor PRE5
TrEMBLA0A068TW954e-57A0A068TW95_COFCA; Uncharacterized protein
STRINGVIT_01s0026g02030.t011e-43(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35324161
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.11e-29bHLH family protein