PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc11_g11750
Common NameGSCOC_T00032405001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family YABBY
Protein Properties Length: 173aa    MW: 19032.7 Da    PI: 9.8586
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc11_g11750genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY147.21.6e-4511461163
        YABBY   1 advfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvss 98 
                  +d++++se++Cyv+CnfCnt+lav +P + l+ +vtv+CGhC +l  +       +++            l+ +   ++ ++++  +  ++ ++s ss
  Cc11_g11750   1 MDLVQQSEHLCYVRCNFCNTVLAVGIPCKRLLDTVTVKCGHCGNLSFL------STRPPPP---------LQGQCFEHQPTIQTFFSDLKKGQSSSSS 83 
                  578999*************************************97442......2333333.........2222223333333333322222222222 PP

        YABBY  99 eklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahf 163
                     s++ + ++p++p v++PPek+ r Psaynrf+keeiqrika+nP+i hreafsaaaknWa +
  Cc11_g11750  84 --SSTSGEPSSPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKATNPEIPHREAFSAAAKNWARY 146
                  ..256778899****************************************************76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046901.5E-546146IPR006780YABBY protein
SuperFamilySSF470958.38E-991144IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.102.9E-5100145IPR009071High mobility group box domain
CDDcd013905.27E-6107143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010254Biological Processnectary development
GO:0010582Biological Processfloral meristem determinacy
GO:0048479Biological Processstyle development
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MDLVQQSEHL CYVRCNFCNT VLAVGIPCKR LLDTVTVKCG HCGNLSFLST RPPPPLQGQC  60
FEHQPTIQTF FSDLKKGQSS SSSSSTSGEP SSPKAPFVVK PPEKKHRLPS AYNRFMKEEI  120
QRIKATNPEI PHREAFSAAA KNWARYIPTA PTGSIAESSN SNHVRFRSGT KL*
Functional Description ? help Back to Top
Source Description
UniProtRegulates carpel specification in flower development. Severe or intermediate mutation in DL causes complete or partial homeotic conversion of carpels into stamens without affecting the identities of other floral organs. Interacts antagonistically with class B genes and controls floral meristem determinacy. Regulates midrib formation in leaves probably by inducing cell proliferation in the central region of the leaf. {ECO:0000269|PubMed:14729915}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00220DAPTransfer from AT1G69180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY4513991e-47AY451399.1 Antirrhinum majus YABBY-like transcription factor CRABS CLAW-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027096329.11e-127protein CRABS CLAW
SwissprotQ76EJ02e-64YABDL_ORYSJ; Protein DROOPING LEAF
TrEMBLA0A068TWY01e-125A0A068TWY0_COFCA; Uncharacterized protein
STRINGXP_002512055.12e-90(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52102339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69180.11e-62YABBY family protein