PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc11_g04550
Common NameGSCOC_T00004809001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family Dof
Protein Properties Length: 96aa    MW: 10624.4 Da    PI: 10.7153
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc11_g04550genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof76.82.7e-2410482462
       zf-Dof 24 yslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                 ysl+qPr+fCk+CrryWtkGGalrnv +Ggg+rknkks+
  Cc11_g04550 10 YSLAQPRHFCKTCRRYWTKGGALRNVLIGGGCRKNKKSK 48
                 9***********************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088417.541146IPR003851Zinc finger, Dof-type
ProDomPD0074784.0E-141046IPR003851Zinc finger, Dof-type
PfamPF027013.3E-181046IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 96 aa     Download sequence    Send to blast
MQFAKHKGFY SLAQPRHFCK TCRRYWTKGG ALRNVLIGGG CRKNKKSKPP SRLTVDPKDT  60
NMTSDIGGLK FFHGLTPAMD FQLGGITSYL LPEGF*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027074289.12e-48dof zinc finger protein DOF5.7-like
RefseqXP_027180024.12e-48dof zinc finger protein DOF5.7-like
SwissprotQ9LSL61e-20DOF57_ARATH; Dof zinc finger protein DOF5.7
TrEMBLA0A068VBC49e-65A0A068VBC4_COFCA; Uncharacterized protein
STRINGXP_006426240.11e-38(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52422234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.16e-23Dof family protein
Publications ? help Back to Top
  1. Castorina G,Fox S,Tonelli C,Galbiati M,Conti L
    A novel role for STOMATAL CARPENTER 1 in stomata patterning.
    BMC Plant Biol., 2016. 16(1): p. 172
    [PMID:27484174]