PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc10_g15260
Common NameGSCOC_T00033701001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family GRAS
Protein Properties Length: 435aa    MW: 49409.4 Da    PI: 6.5131
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc10_g15260genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS247.36e-76594274374
         GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvsel.ykalppsetsekn....sseelaalklfsevsPilkfshl 96 
                  lL ++Ae v++++  +a++lL      as++g+p+qR++ +f+eAL++++ +++     + l  +  ++ +    ++    a+ + ++ +P+  f+ +
  Cc10_g15260  59 LLQAAAEKVANQQYVQARKLLILCGCFASKSGSPVQRVVYCFAEALEKKIEQEWGIApTEELVGKLRKPLDemlaQVYMQPAMMTSQQETPFTLFTEF 156
                  678899*********************************************9764321222322222222222223444445566999********** PP

         GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlelee 193
                  ta + Il+av++++rvH iDf+i++G++W  ++qaLa R e p  +l+i +vg     sk+ +eetg+ L++fAe+l++pf++++ v+++l+dl+ + 
  Cc10_g15260 157 TATESILNAVASAKRVHLIDFQINNGAHWTLIMQALAVRYECPFeHLKISAVGT----SKKIMEETGKWLSSFAETLNLPFSYKM-VVSDLKDLRENY 249
                  ***************************************966545*********....9**************************.7999******** PP

         GRAS 194 LrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellg 291
                  ++++ +E la+ + ++l + l      +++ ++++ ++++l+P++vvv e ea++n+++F erf  al  +sa+fd++++ + ++   r++ E++++ 
  Cc10_g15260 250 FELEFDEELAIYSDMRLWTQL----VWPNHLKALMGVIRKLKPRIVVVKEFEANTNAPNFPERFDAALLLFSAMFDCINSCMDHHVLYRKMTEEVIFP 343
                  ***************999998....45555667*************************************************9999************ PP

         GRAS 292 reivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  r ++n++ +eg er++rhe+ + Wr+ + e+G+ +  l+ +  ++a+l lr  +     +v+ + ++l++gWk+ p  s+SaW+
  Cc10_g15260 344 RMVQNIIVAEGMERFQRHEKIGFWRKLFAEFGMAETDLTRSSLCEASLFLRSSErLSSCTVDMDGKCLIMGWKGAPFQSLSAWK 427
                  ******************************************************9888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098538.9330406IPR005202Transcription factor GRAS
PfamPF035142.1E-7359427IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MDTSHHPALS TASLMKAAKA QLFKFNSQKI DVLSYVSSHI GTLSGLRSEV PGDLELALLL  60
QAAAEKVANQ QYVQARKLLI LCGCFASKSG SPVQRVVYCF AEALEKKIEQ EWGIAPTEEL  120
VGKLRKPLDE MLAQVYMQPA MMTSQQETPF TLFTEFTATE SILNAVASAK RVHLIDFQIN  180
NGAHWTLIMQ ALAVRYECPF EHLKISAVGT SKKIMEETGK WLSSFAETLN LPFSYKMVVS  240
DLKDLRENYF ELEFDEELAI YSDMRLWTQL VWPNHLKALM GVIRKLKPRI VVVKEFEANT  300
NAPNFPERFD AALLLFSAMF DCINSCMDHH VLYRKMTEEV IFPRMVQNII VAEGMERFQR  360
HEKIGFWRKL FAEFGMAETD LTRSSLCEAS LFLRSSERLS SCTVDMDGKC LIMGWKGAPF  420
QSLSAWKLQN EYEI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-308642733375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027093864.10.0DELLA protein GAI-like
TrEMBLA0A068USZ70.0A0A068USZ7_COFCA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA85001728
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.15e-46GRAS family protein