PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc09_g09490
Common NameGSCOC_T00017119001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family TCP
Protein Properties Length: 328aa    MW: 35840.4 Da    PI: 9.8936
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc09_g09490genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP967.3e-3049134388
          TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssg 88 
                  g+kdrhsk++T +g+RdRR+Rls+++a++++dLqd+LG+ ++sk ++WL+ + k +i++l+ ++ ++ s+++ ++    +++ss++
  Cc09_g09490  49 GGKDRHSKVCTVRGLRDRRIRLSVPTAIQLYDLQDRLGLSQPSKVVDWLIDATKSEIDKLPPLQIQAGSFSQFHQAIALSQHSSAT 134
                  79*************************************************************88888777444444444433333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136929.71950108IPR017887Transcription factor TCP subgroup
PfamPF036343.7E-2750160IPR005333Transcription factor, TCP
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MIMNSKDKAF QTKQEGDVND SKFSKSASTS RPWAGFRNPR IVRVSRSFGG KDRHSKVCTV  60
RGLRDRRIRL SVPTAIQLYD LQDRLGLSQP SKVVDWLIDA TKSEIDKLPP LQIQAGSFSQ  120
FHQAIALSQH SSATSSNLPH FFCANPSYMK DVGAPSFLSN KQGLKINDHI HGNTNLSSFP  180
SLLPNPLPYN PYYQWEASNL SLSQLGGHSN IPMQPEDSQS HNALSLGSSM ALPSGSQLCF  240
CPSAATIPTI LPSLPPYMTA SVESDPRQSN NFQFLSSSTQ QVQANSLMPT LHLISSPLKS  300
LTLNSNPKIL HLQENSKNHP NKGDSGS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A4e-1955109155Putative transcription factor PCF6
5zkt_B4e-1955109155Putative transcription factor PCF6
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00008PBMTransfer from 496250Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027080286.10.0transcription factor TCP5-like
TrEMBLA0A068V8430.0A0A068V843_COFCA; Uncharacterized protein
STRINGXP_002514641.12e-96(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8212499
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.11e-46TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5