PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc09_g04160
Common NameGSCOC_T00017460001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family LBD
Protein Properties Length: 153aa    MW: 16902.2 Da    PI: 8.3168
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc09_g04160genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260120.97.3e-3851041100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +Ca+Ck+lrr+C+++C+l+p+fp ++p++fa+vhk++Gasnv k+l+++p ++r +a+++++yeA +r++dPvyG+vg++  lqqq+  ++ +la+++
  Cc09_g04160   5 RCAGCKYLRRRCPSNCILSPHFPPNDPQRFACVHKIYGASNVAKMLQQVPVQQRAEAANAMYYEAYCRIKDPVYGCVGTVALLQQQIFDAECQLAKIQ 102
                  6**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  Cc09_g04160 103 AE 104
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.7074105IPR004883Lateral organ boundaries, LOB
PfamPF031957.8E-385102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
MNSKRCAGCK YLRRRCPSNC ILSPHFPPND PQRFACVHKI YGASNVAKML QQVPVQQRAE  60
AANAMYYEAY CRIKDPVYGC VGTVALLQQQ IFDAECQLAK IQAEIAVLNG HREATHQNQQ  120
VKVATSSANF TLESGGEGTF SSTYDPSICQ FY*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00381DAPTransfer from AT3G26620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011030192.13e-57PREDICTED: LOB domain-containing protein 24-like
SwissprotP594676e-53LBD23_ARATH; LOB domain-containing protein 23
TrEMBLA0A068U7911e-112A0A068U791_COFCA; Uncharacterized protein
STRINGPOPTR_0012s13910.12e-56(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52772039
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26620.11e-48LOB domain-containing protein 23