PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc09_g02770
Common NameGSCOC_T00017631001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family LBD
Protein Properties Length: 207aa    MW: 22367.6 Da    PI: 5.2662
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc09_g02770genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.41e-42511501100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca++Cvlapyfp ++p kf ++hk+FGasn++k+l++lpe++r da++s+vyeA+ r+rdPvyG++g i +lq+q+++l+aela+++
  Cc09_g02770  51 PCAACKILRRRCAEKCVLAPYFPPTEPLKFTIAHKVFGASNIIKMLQELPEDQRADAVNSMVYEANSRIRDPVYGCAGAICQLQKQISELQAELAKAQ 148
                  7***********************************************************************************************99 PP

       DUF260  99 ee 100
                  +e
  Cc09_g02770 149 AE 150
                  86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.40850151IPR004883Lateral organ boundaries, LOB
PfamPF031958.4E-4351148IPR004883Lateral organ boundaries, LOB
Gene3DG3DSA:1.20.58.609.4E-4103176No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MECSSTTTTT TTICAASQNQ SLSPSSSPSL SPRAGSPKNG PPSPPPVILS PCAACKILRR  60
RCAEKCVLAP YFPPTEPLKF TIAHKVFGAS NIIKMLQELP EDQRADAVNS MVYEANSRIR  120
DPVYGCAGAI CQLQKQISEL QAELAKAQAE MLNLQCQNDN LKSLICMGMA AQGDREIMSE  180
QHLSCDNTSL FLDDANIYAA WEPLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009611728.18e-93PREDICTED: LOB domain-containing protein 1-like
RefseqXP_016497689.18e-93PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR03e-72LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A068U7261e-152A0A068U726_COFCA; Uncharacterized protein
STRINGSolyc05g048740.2.16e-88(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-64LOB domain-containing protein 1