PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc08_g16330
Common NameGSCOC_T00035590001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family ARF
Protein Properties Length: 694aa    MW: 76525.1 Da    PI: 6.5474
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc08_g16330genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.21.5e-23128228198
                  EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                  f+kvlt sd++++g +++ +k+a+e+     + ++  +++l+ +d++g +W +k+i+r++++r++lt+GW+ Fv +++L +gD++vF   +  ++el+
  Cc08_g16330 128 FCKVLTASDTSTHGGFSVLRKHANEClppldMTQPVPTQELVAKDLHGTEWHFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDSFVFL--RGASGELR 223
                  99****************************9555556669************************************************..3489999* PP

                  EEEE- CS
           B3  94 vkvfr 98 
                  v+v+r
  Cc08_g16330 224 VGVRR 228
                  **997 PP

2Auxin_resp101.51.1e-33254333183
   Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                  a+ha++t++ F v+Y+Pr+  s+F++ ++k+++++++ + vGmRfkm+fe+eds+err+sGt+vgv+d  +++W++SkWrsLk
  Cc08_g16330 254 ASHAVATGTLFVVYYKPRT--SQFIIGLNKYLESINNGFGVGMRFKMRFEGEDSPERRFSGTIVGVED-ISLQWKDSKWRSLK 333
                  789***************6..9**********************************************.667*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.09E-40118257IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.8E-40120243IPR015300DNA-binding pseudobarrel domain
CDDcd100173.40E-21126228No hitNo description
PROSITE profilePS5086311.984128230IPR003340B3 DNA binding domain
PfamPF023621.6E-21128228IPR003340B3 DNA binding domain
SMARTSM010193.4E-21128230IPR003340B3 DNA binding domain
PfamPF065071.6E-31254333IPR010525Auxin response factor
PfamPF023091.6E-10571664IPR033389AUX/IAA domain
SuperFamilySSF542772.75E-12579657No hitNo description
PROSITE profilePS5174522.891581662IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 694 aa     Download sequence    Send to blast
MASRGSLIQQ HQSNGSVEGQ DDLYTELWKA CAGPLVDVPK PKESVYYFPQ GHMEQLEAST  60
NQELNQRIPM FGLPPKILCN VVDIQLLAEQ ETDEVYAQIT LIPEPDHTEQ TSPDSCPSEP  120
PKPTVHSFCK VLTASDTSTH GGFSVLRKHA NECLPPLDMT QPVPTQELVA KDLHGTEWHF  180
KHIFRGQPRR HLLTTGWSTF VTSKRLVAGD SFVFLRGASG ELRVGVRRFA RQQSSMPSSV  240
ISSHSMHLGV LATASHAVAT GTLFVVYYKP RTSQFIIGLN KYLESINNGF GVGMRFKMRF  300
EGEDSPERRF SGTIVGVEDI SLQWKDSKWR SLKVQWDEPA SITRPERVSP WEIEPFVAAV  360
PTSLVPSVTG KNKRLRSHSD LLPPESASST ASAVWNPPHD SPLGNGTAEC PRSQLRSANQ  420
NHMDISCSQL QGSRNCNLRT HAEGDWLSSS QGNTSVSRFA DETESKSTIA WTTFTGCSAT  480
PAKLSNHSQS HLHDGRKPDT VASCRLFGID LISPSTGALD KELLKPANAS NVTTQDCLPN  540
TLSGCGSEHK SDLSKDSKDQ IVGQLQLPSK EVQSKQSGST RSRTKVQMQG VAVGRAVDLT  600
MLTGYNELIV ELEKMFEIKG ELSPRNKWEI IFTDDEGDMM LMGDDPWPEF CKMVRRIFIC  660
SGQDVKIMRA GSKLPLPSAD NDGTTFNWEN GED*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1762135617355Auxin response factor 1
4ldw_A1e-1762135617355Auxin response factor 1
4ldw_B1e-1762135617355Auxin response factor 1
4ldx_A1e-1762135617355Auxin response factor 1
4ldx_B1e-1762135617355Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027081169.10.0auxin response factor 9-like isoform X1
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A068UX670.0A0A068UX67_COFCA; Auxin response factor
STRINGGorai.003G078000.10.0(Gossypium raimondii)
STRINGXP_009592767.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9