PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc08_g12950
Common NameGSCOC_T00030407001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family YABBY
Protein Properties Length: 190aa    MW: 21038.8 Da    PI: 7.8875
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc08_g12950genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY224.82.3e-69161832170
        YABBY   2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsse 99 
                  d+  sseq+Cyv+Cn C+t+lavsvP tslf++vtvrCGhCt+ll vn  ++  ll++ ++l++++ ++      +  ++++s + +   ++t+ s +
  Cc08_g12950  16 DHLASSEQLCYVHCNICDTVLAVSVPCTSLFQTVTVRCGHCTNLLPVN--MRGLLLPSANQLHNHFGHTFFSPSPNFLDQISSPTPNFLMNQTTASDF 111
                  67889****************************************965..667789999999999988866666666666666555555555555555 PP

        YABBY 100 kl.senedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                  +l ++    ++pr+p ++rPPe+rqr+Psaynrfikeeiqrika+nPdishreafsaaaknWahfP+i fgl
  Cc08_g12950 112 TLpPQTGFSDLPRPPVMNRPPERRQRIPSAYNRFIKEEIQRIKATNPDISHREAFSAAAKNWAHFPHIQFGL 183
                  6646777899***999******************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046901.1E-6820183IPR006780YABBY protein
SuperFamilySSF470953.27E-8126177IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.104.7E-5132177IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MSSSSTSSTT TTLSLDHLAS SEQLCYVHCN ICDTVLAVSV PCTSLFQTVT VRCGHCTNLL  60
PVNMRGLLLP SANQLHNHFG HTFFSPSPNF LDQISSPTPN FLMNQTTASD FTLPPQTGFS  120
DLPRPPVMNR PPERRQRIPS AYNRFIKEEI QRIKATNPDI SHREAFSAAA KNWAHFPHIQ  180
FGLMPDQTV*
Functional Description ? help Back to Top
Source Description
UniProtSeems to be associated with phloem cell differentiation. {ECO:0000269|PubMed:17676337}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027182759.11e-137protein YABBY 4-like
RefseqXP_027182760.11e-137protein YABBY 4-like
RefseqXP_027182761.11e-137protein YABBY 4-like
SwissprotA2X7Q34e-70YAB4_ORYSI; Protein YABBY 4
SwissprotQ6H6684e-70YAB4_ORYSJ; Protein YABBY 4
TrEMBLA0A068UNT11e-137A0A068UNT1_COFCA; Uncharacterized protein
STRINGVIT_02s0154g00070.t011e-106(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38124163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45190.17e-69YABBY family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Yang C,Ma Y,Li J
    The rice YABBY4 gene regulates plant growth and development through modulating the gibberellin pathway.
    J. Exp. Bot., 2016. 67(18): p. 5545-5556
    [PMID:27578842]