PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc08_g06390
Common NameGSCOC_T00040935001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family CO-like
Protein Properties Length: 347aa    MW: 38156.6 Da    PI: 6.4391
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc08_g06390genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.83.8e-071143436
     zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
                 + C+ ++   ++ fC+ ++ +lC  C +++H  
  Cc08_g06390 11 KPCDSCKATSASVFCRADSAFLCLACDSKIHAA 43
                 67******99*********************54 PP

2zf-B_box27.66.2e-095398342
     zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                  ++C+ +e+ +++  C+ +   lC+ C   +H+       H+++p+
  Cc08_g06390 53 VWVCEVCEQAPASVTCKADAAALCNACDRDIHSAnplarrHERIPI 98
                 689*****************************66899999999886 PP

3CCT69.77.4e-24283327145
          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                  Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k+ae
  Cc08_g06390 283 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRAE 327
                  9*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.997855IPR000315B-box-type zinc finger
SMARTSM003362.6E-11855IPR000315B-box-type zinc finger
PfamPF006433.9E-51150IPR000315B-box-type zinc finger
CDDcd000213.20E-71255No hitNo description
PROSITE profilePS5011910.6515198IPR000315B-box-type zinc finger
PfamPF006431.7E-75398IPR000315B-box-type zinc finger
CDDcd000214.24E-85498No hitNo description
SMARTSM003366.5E-105698IPR000315B-box-type zinc finger
PROSITE profilePS5101716.787283325IPR010402CCT domain
PfamPF062036.5E-18283325IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MGAEGWSLTA KPCDSCKATS ASVFCRADSA FLCLACDSKI HAANKLASRH GRVWVCEVCE  60
QAPASVTCKA DAAALCNACD RDIHSANPLA RRHERIPITP FFDSASAARC TGASDEKCLL  120
DLGSEAEEAE AASWLLPNPN CNKDLEPDSP EYKTADYLFT DMDPYLDMDL ISSDQKPHVV  180
QYQNHHHNHV HQQHNSDGVV PVQNKNDPTH LPGPVVDGFP TYEMDFAGSK SFMYNFSSQS  240
ISQSVSSSSM EVGVVPDHNA MADVSNNFSR SDAVTNPVSG VDREARVLRY REKRKNRKFE  300
KTIRYASRKA YAETRPRIKG RFAKRAEVEI ESLIVADASY GVVPTY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLC0293961e-33LC029396.1 Gentiana triflora GtCOL4 mRNA for gentian CONSTANS-like4 homolog, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027084679.10.0zinc finger protein CONSTANS-LIKE 4-like
SwissprotQ940T91e-102COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A068V3I50.0A0A068V3I5_COFCA; Uncharacterized protein
STRINGXP_009758697.11e-171(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.12e-98CONSTANS-like 4