PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc07_g13810
Common NameGSCOC_T00036694001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family Dof
Protein Properties Length: 361aa    MW: 38753.9 Da    PI: 9.1375
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc07_g13810genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.63.8e-403393262
       zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                 +e+al+cprCds+ntkfCyynnysl+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknkks+
  Cc07_g13810 33 QEQALQCPRCDSQNTKFCYYNNYSLTQPRHFCKTCRRYWTKGGALRNVPIGGGSRKNKKSK 93
                 67999*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-223482IPR003851Zinc finger, Dof-type
PfamPF027016.1E-343591IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.2453791IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103975IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010052Biological Processguard cell differentiation
GO:0010118Biological Processstomatal movement
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1902066Biological Processregulation of cell wall pectin metabolic process
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MAPVSMAAKS SAANKDENNH GSGTRKSTSA RSQEQALQCP RCDSQNTKFC YYNNYSLTQP  60
RHFCKTCRRY WTKGGALRNV PIGGGSRKNK KSKPPSRLTV DPKDANMTSD IGGLKFFHGL  120
TPAMDFQLGG ITSFSRVLTN HSSPTSIYNQ LSSSFGDISI SGTTSGAITS SPCFNLDPSA  180
SSGGSLMGFN FPFSSVPKPA GDHGTALGFS TTTGDVHSSL AYSIESLSSI NQDLHYKLQQ  240
QRLAMLYGTT GEDQKVMMST SVNPSVPFEK PQPILFHNLE NSTTPKTNVS GVDINSRKEG  300
INGASLSTEW FFDNTTYAPV TPTPTNSGGN GGSDQNHLVN HNWNGMTNPV WNNLSQYSAL  360
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027180024.10.0dof zinc finger protein DOF5.7-like
TrEMBLA0A068U1W30.0A0A068U1W3_COFCA; Uncharacterized protein
STRINGXP_006426240.11e-114(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52422234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.19e-40Dof family protein