PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc07_g05740
Common NameGSCOC_T00039854001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family LBD
Protein Properties Length: 293aa    MW: 32148.4 Da    PI: 7.4708
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc07_g05740genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.21.2e-4271061100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk lrrkC+++Cv+apyfp +qp+kf nvh++FGasnv kll++l + +reda++sl+yeAe r+rdPvyG+vg+i+ lqq+l+q++++l+ +k
  Cc07_g05740   7 PCAACKCLRRKCTQECVFAPYFPPDQPQKFINVHRVFGASNVAKLLNELGTGQREDAVNSLAYEAEYRLRDPVYGCVGLISILQQKLKQVQHDLNNAK 104
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  Cc07_g05740 105 KE 106
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.1156107IPR004883Lateral organ boundaries, LOB
PfamPF031957.5E-427104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MSSSNSPCAA CKCLRRKCTQ ECVFAPYFPP DQPQKFINVH RVFGASNVAK LLNELGTGQR  60
EDAVNSLAYE AEYRLRDPVY GCVGLISILQ QKLKQVQHDL NNAKKELATY IGPSAMLPIF  120
QHPGFMQQHP NNPSASTVMP YAMQPMMGLP TGVAAPHGGP LIIRDAQQQQ QMYEAQQYAA  180
AVAARDQEMF RAYEQQQQQQ PPPQELMRFN SGFEGAGPAA ATAFNTMSCG AAMSPSLALG  240
SYEAFQLESQ LMLQQQQPQQ LPLQSHHQPQ AAQQQHPQRA KSEEGRSVGP SC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099212.11e-117PREDICTED: LOB domain-containing protein 36
SwissprotQ9FKZ36e-85LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A068U2S40.0A0A068U2S4_COFCA; Uncharacterized protein
STRINGSolyc02g065150.1.11e-114(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.13e-82ASYMMETRIC LEAVES 2-like 1