PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc07_g04710
Common NameGSCOC_T00039728001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family bZIP
Protein Properties Length: 181aa    MW: 21141.4 Da    PI: 5.588
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc07_g04710genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.51.9e-1582131554
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                  +++rr+++NRe+ArrsR RK++ ++eL   v  L +eN++L+++l++ ++
  Cc07_g04710  82 RKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLIDKLNHASE 131
                  689***************************************99998665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.3E-1478142IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.17480143IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.1E-1382155No hitNo description
SuperFamilySSF579591.5E-1382131No hitNo description
PfamPF001703.7E-1382130IPR004827Basic-leucine zipper domain
CDDcd147026.97E-1983134No hitNo description
PROSITE patternPS00036085100IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MQSGDATELY YLLTSNPTQY PSHFGLNNNN MPSFNLSRIS NPLCHLQINP QIQDFNPQMA  60
SFSCNSTSDE ADDQQLSIIN ERKQRRMISN RESARRSRMR KQKHLDELWS QVVWLRNENH  120
QLIDKLNHAS ECHDRVLQEN TQLKEEASEL RQMLTEMQLN SPYYNLRDLE DDPCKGLSQD  180
*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
194101RRSRMRKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027073396.11e-132basic leucine zipper 43-like isoform X1
RefseqXP_027073397.11e-132basic leucine zipper 43-like isoform X2
SwissprotQ9FMC28e-41BZP43_ARATH; Basic leucine zipper 43
TrEMBLA0A068U1H71e-130A0A068U1H7_COFCA; Uncharacterized protein
STRINGVIT_14s0083g00700.t013e-90(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9472492
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.15e-52basic leucine-zipper 42
Publications ? help Back to Top
  1. Nowak K,Gaj MD
    Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis.
    J. Plant Physiol., 2016. 193: p. 119-26
    [PMID:26973252]
  2. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]