PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc07_g03280
Common NameGSCOC_T00039554001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family bHLH
Protein Properties Length: 239aa    MW: 26560.8 Da    PI: 7.0264
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc07_g03280genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH16.12.1e-053163134
                 CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...T CS
          HLH  1 rrrahnerErrRRdriNsafeeLrellPkaskap 34
                 +r  + erE++ Rd++N  f eLr+ + +a   +
  Cc07_g03280 31 KRIHKAEREKKKRDHMNVLFVELRKAIEPAQ-LS 63
                 688899*********************9973.23 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474591.44E-102192IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.101.2E-72797IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000837.93E-52884No hitNo description
PROSITE profilePS5088810.5313080IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MASETAIPDG DEGNAVHRHS SSKKKQGKPS KRIHKAEREK KKRDHMNVLF VELRKAIEPA  60
QLSSGKACIV NDTIRLLKDL LAQVDSLKKD NAALLSESHY VAVEKNELIE ENSALKSQVE  120
KLQSEITERT QSQSSVNLNI WPSQSPIAAS ELQEDSLRLP STDHQLLSSS VVAPIFVVPL  180
HHDSPIYHKG SQNDTAEDFQ CNAFLSNVKK PRPRYPSPSD SWPSQILDEQ LSGREITQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12242KKKQGKPSKRIHKAEREKKKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002283284.11e-62PREDICTED: transcription factor bHLH47-like
RefseqXP_002283289.11e-62PREDICTED: transcription factor bHLH47-like
RefseqXP_010258393.12e-62PREDICTED: transcription factor bHLH47-like
RefseqXP_010258394.12e-62PREDICTED: transcription factor bHLH47-like
TrEMBLA0A068U3Q91e-175A0A068U3Q9_COFCA; Uncharacterized protein
STRINGVIT_14s0108g00480.t016e-61(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43071934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47640.35e-38bHLH family protein