PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc06_g20540
Common NameGSCOC_T00022994001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family LBD
Protein Properties Length: 297aa    MW: 32943.7 Da    PI: 5.5305
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc06_g20540genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.65e-39101101101
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  aCaaCk++rr+C++dC+lapyfpa+qpk f+n+hklFG+sn+lk+l++l+++++  am+s++y+A++r + Pv+G++g+i++l  q++ +++el++++
  Cc06_g20540  10 ACAACKYQRRRCTADCPLAPYFPADQPKMFQNAHKLFGVSNILKVLRQLDPSQKLVAMKSIIYQANIRDKYPVHGCLGIIQQLWYQIQLAEEELQAIH 107
                  7**********************************************************************************************999 PP

       DUF260  99 eel 101
                  ++l
  Cc06_g20540 108 AQL 110
                  875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.8329110IPR004883Lateral organ boundaries, LOB
PfamPF031951.4E-3710106IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MTLKGGTSQA CAACKYQRRR CTADCPLAPY FPADQPKMFQ NAHKLFGVSN ILKVLRQLDP  60
SQKLVAMKSI IYQANIRDKY PVHGCLGIIQ QLWYQIQLAE EELQAIHAQL AFYRQHQQQE  120
VSTGLSDSIS QLQLGMAPPS NALSLFHQDA PQNYDNTVSA LPIGSHPTYS SNSANAANYN  180
ATYMDSKENN AVNSLWVQQP PYNNSSSNIN SNPMVMQSQL INSQPLIIQQ DCGTQDYDEM  240
HPFFDTIDDR QSYIASKEAY ESSSESSLKD TTQSVEHVAE NELKSAAACF SLTSVN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016482365.11e-143PREDICTED: LOB domain-containing protein 27-like
TrEMBLA0A068UF740.0A0A068UF74_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000342881e-135(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14492375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.16e-57LOB domain-containing protein 27