PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc06_g19110
Common NameGSCOC_T00028962001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family bHLH
Protein Properties Length: 222aa    MW: 25043.1 Da    PI: 8.6044
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc06_g19110genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH31.14.3e-1065117155
                  CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
          HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                  ++ +hn+ Er RR+riN  ++ L      a  ++skKls  +++ ++ +YI +Lq
  Cc06_g19110  65 KKLNHNASERDRRKRINGLYSSLPIYTNCA--QQSKKLSIPTTVSRVLKYIPELQ 117
                  6789*******************9999996..6*******************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.280.105.4E-863138IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088810.98864116IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000102.7E-765117IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000832.26E-765121No hitNo description
SuperFamilySSF474596.15E-1265136IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003536.6E-470122IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010106Biological Processcellular response to iron ion starvation
GO:0055072Biological Processiron ion homeostasis
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MLTISPPLFS YPLGDLRSYE QNGSYHGETE TSESLLNSPT FRQQVGQNHE SHQFSSVNDQ  60
SKTVKKLNHN ASERDRRKRI NGLYSSLPIY TNCAQQSKKL SIPTTVSRVL KYIPELQKEV  120
ESLIEKKECL KTKISEQENS SPLRKQRNLG SSTQIPSSTV SASRLSDREV MVQISTMKFS  180
KCSYADVLSS LEQDGFFSLN SSCFESFGER VFHSLHLEVH P*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027069340.11e-145transcription factor bHLH100-like
TrEMBLA0A068ULW71e-160A0A068ULW7_COFCA; Uncharacterized protein
STRINGVIT_13s0047g00450.t016e-62(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22262256
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56970.16e-46bHLH family protein