PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc06_g13690
Common NameGSCOC_T00041358001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family CO-like
Protein Properties Length: 414aa    MW: 44796 Da    PI: 7.1103
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc06_g13690genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.54.1e-062969438
     zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                 + C+ +++  + lfC++++ ++C  C ++ H        H+
  Cc06_g13690 29 KPCDCCSSAAALLFCRTDSLFMCMACDSKMHATnkigsrHE 69
                 57******99*******************996556666666 PP

2zf-B_box26.21.6e-0871116342
     zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                   ++C+ +e+ +++  C+ +   lC +C   +H+       H+++p+
  Cc06_g13690  71 VWMCEVCEQAPASVTCKADAAALCVTCDRDIHSAnplarrHERSPV 116
                  689*****************************66888888998875 PP

3CCT69.49.4e-24339383145
          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                  Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k+ae
  Cc06_g13690 339 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRAE 383
                  9*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003369.5E-52673IPR000315B-box-type zinc finger
CDDcd000217.21E-63073No hitNo description
PROSITE profilePS501198.9583173IPR000315B-box-type zinc finger
PROSITE profilePS5011910.80869116IPR000315B-box-type zinc finger
PfamPF006431.2E-671116IPR000315B-box-type zinc finger
CDDcd000215.57E-972116No hitNo description
SMARTSM003362.3E-1074116IPR000315B-box-type zinc finger
PfamPF062038.3E-18339381IPR010402CCT domain
PROSITE profilePS5101716.787339381IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MGRVAEDGGG TGVVANNRGV PAAWGLVAKP CDCCSSAAAL LFCRTDSLFM CMACDSKMHA  60
TNKIGSRHER VWMCEVCEQA PASVTCKADA AALCVTCDRD IHSANPLARR HERSPVVPFY  120
DTAESVVKST AATLLVPLPP PAVDNSSNTG ANNTVNDTCH GHDAKMTTCF AHESYMSDPW  180
ISSNPMNSKL PTDAPEFKSV EFLFSDSDNY LDFDYRISSG ARIQQHYTSS GTDGVVPVQT  240
TKPPILPAQL PGHHEPSEKH FEIDFTKSHI SSYTPSYTSH SLSQSVSSSS LDVGVVPDGS  300
SVSEISYPFG RNLSGSTADL SGSSSGGNNQ GSQLPGMDRE ARVLRYREKR KNRKFEKTIR  360
YASRKAYAET RPRIKGRFAK RAEAIESEID QMFTCPGSAA FFPESRYGVV PSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027068408.10.0zinc finger protein CONSTANS-LIKE 4-like
SwissprotQ940T92e-97COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A068U4410.0A0A068U441_COFCA; Uncharacterized protein
STRINGXP_009608073.11e-144(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.12e-88CONSTANS-like 4