PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc06_g04110
Common NameGSCOC_T00023718001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family TCP
Protein Properties Length: 231aa    MW: 24737.9 Da    PI: 6.9614
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc06_g04110genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP109.45.5e-3467134673
          TCP   6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                  ++ +++hTkv+gR+RRvR++a+caar+F+L++eLG+ +d++tieWLl+qa+pa+ ++tg+++ +++ +
  Cc06_g04110  67 KKPKDRHTKVNGRGRRVRMPALCAARIFQLTRELGHRSDGETIEWLLRQAEPAVVAATGSGTFPKTMV 134
                  6789********************************************************76666332 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036346.1E-3069148IPR005333Transcription factor, TCP
PROSITE profilePS5136927.00969123IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MVLHPRTNGS HSQAKDNVPD PDLSATSPDL QLLSSVAAAA AADDDTANAS SLSIIEQQQP  60
EQPVPPKKPK DRHTKVNGRG RRVRMPALCA ARIFQLTREL GHRSDGETIE WLLRQAEPAV  120
VAATGSGTFP KTMVTSVGSL PTSHLSESTY ATVTRVHPSA VVIPGMGGFF AVPPPPMCRL  180
DLRQPPPTEL SGGINAYSQM PYTALLLEPS PRGEEHAESS AKNRDDFWHL *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027073001.11e-168transcription factor TCP11
SwissprotQ9SJK72e-35TCP11_ARATH; Transcription factor TCP11
TrEMBLA0A068UDZ41e-168A0A068UDZ4_COFCA; Uncharacterized protein
STRINGSolyc09g008030.1.11e-51(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24824201
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37000.12e-36TCP family protein