PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc04_g01330
Common NameGSCOC_T00021776001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family GRAS
Protein Properties Length: 545aa    MW: 60551.7 Da    PI: 6.9074
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc04_g01330genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS253.39.2e-781615382374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                  ++lL  cA a+++++ +++q+lL  + elas +gd+++Rlaa+ ++AL+++la+ +s++ +a +++ +s +n +  + +l  fs++ P++++ + +aN
  Cc04_g01330 161 EQLLNPCAAAITASNPSRVQHLLYVIDELASLTGDANHRLAAHGLRALKHHLASPGSSVTSAGSTTFAS-TNPKFFTESLINFSDINPWFRIPNSIAN 257
                  689***************************************************999999887666665.677888888888**************** PP

         GRAS 100 qaIleavege...ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg.........skeeleetgerLakfAeelgvpfefnvlvak 184
                  + Il+ ++++   + +Hi+D ++s+G+QWp+Ll++L+ R+ ++pp +RiT + + +++          + +  +  ++L  fA+++++++++n l   
  Cc04_g01330 258 SSILQILQEQnqpRNLHIVDVGVSHGIQWPTLLEELTRRSgGPPPLVRITLITRTNHEeqsrntpfaASPSGYNCSSQLLGFAKKININLQINRLDNF 355
                  *******999888899************************55666*******9987778889999988889999********************8777 PP

         GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh...nsesFlerflealeyysalfdsleaklpres 279
                   l++l+ + ++ +p+E+l+++ +++lh+l    ++ ++ r+ +Lk+++s++Pk vv++e++ad+   n  +F+++f++ +ey + ++ds ++ +    
  Cc04_g01330 356 PLQNLNSQVIKSSPDETLIICTQFRLHNLN---HNNPDDRTYFLKVLRSMEPKGVVLTENNADCschNCVDFATGFSRRVEYLWRFLDSASVAY---- 446
                  *****************************8...66666778*******************9775324777********************8885.... PP

         GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  + r + Er++++ e+ ++++++g++    +e++ekW er+ ++GF+   ++e+a++ a++llrk++ +++ rve+++g++ l Wk++p+ ++S W+
  Cc04_g01330 447 KGRESDERRMMEGEAAKALTNAGEM----NERKEKWCERMASVGFSRQVFGEDAVDGARALLRKYDsNWEIRVEDRDGCVGLWWKGQPVSFCSLWK 538
                  66666677777778999******99....88888********************************9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.609134517IPR005202Transcription factor GRAS
PfamPF035143.2E-75161538IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042446Biological Processhormone biosynthetic process
GO:2000032Biological Processregulation of secondary shoot formation
Sequence ? help Back to Top
Protein Sequence    Length: 545 aa     Download sequence    Send to blast
MINEEPDPNP MSDHNILEWI EGSLPFLPPI FDDPYDSWWQ LHVPAPDQEQ INRCSTSFDS  60
NVSTVTAATS ATLPEPPAAI PSDHPRPSDS SKKRKASDDH APKTSQISRK SQNRRNNNEG  120
DEGETIVEQG LVPARKSSGS KKAAAKSGGN TCNNKDGRWA EQLLNPCAAA ITASNPSRVQ  180
HLLYVIDELA SLTGDANHRL AAHGLRALKH HLASPGSSVT SAGSTTFAST NPKFFTESLI  240
NFSDINPWFR IPNSIANSSI LQILQEQNQP RNLHIVDVGV SHGIQWPTLL EELTRRSGGP  300
PPLVRITLIT RTNHEEQSRN TPFAASPSGY NCSSQLLGFA KKININLQIN RLDNFPLQNL  360
NSQVIKSSPD ETLIICTQFR LHNLNHNNPD DRTYFLKVLR SMEPKGVVLT ENNADCSCHN  420
CVDFATGFSR RVEYLWRFLD SASVAYKGRE SDERRMMEGE AAKALTNAGE MNERKEKWCE  480
RMASVGFSRQ VFGEDAVDGA RALLRKYDSN WEIRVEDRDG CVGLWWKGQP VSFCSLWKIA  540
PDTK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B2e-3315453881473Protein SHORT-ROOT
5b3h_B7e-3415453827419Protein SHORT-ROOT
5b3h_E7e-3415453827419Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator essential for Nod-factor-induced gene expression. Acts downstream of calcium spiking. May be a target of DMI3, a calcium/calmodulin-dependent protein kinase (CCaMK) (PubMed:15961669). Is essential for Nod factor-elicited expression of ERN1 (PubMed:23077241). {ECO:0000269|PubMed:15961669, ECO:0000269|PubMed:23077241}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced after treatment with Sinorhizobium meliloti. {ECO:0000269|PubMed:15961669}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027124732.10.0nodulation-signaling pathway 1 protein-like
SwissprotQ4VYC80.0NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBLA0A068TP920.0A0A068TP92_COFCA; Uncharacterized protein
STRINGXP_009594760.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49492139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-155GRAS family protein
Publications ? help Back to Top
  1. Cerri MR, et al.
    Medicago truncatula ERN transcription factors: regulatory interplay with NSP1/NSP2 GRAS factors and expression dynamics throughout rhizobial infection.
    Plant Physiol., 2012. 160(4): p. 2155-72
    [PMID:23077241]
  2. Tang H, et al.
    An improved genome release (version Mt4.0) for the model legume Medicago truncatula.
    BMC Genomics, 2014. 15: p. 312
    [PMID:24767513]