PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc03_g07780
Common NameGSCOC_T00026642001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family G2-like
Protein Properties Length: 326aa    MW: 35062.7 Da    PI: 7.1536
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc03_g07780genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like108.82.8e-3465119155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQkYRl
  Cc03_g07780  65 KPRLRWTAELHERFVDAVTQLGGPDKATPKTIMRTMGVKGLTLYHLKSHLQKYRL 119
                  79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-3362120IPR009057Homeodomain-like
PROSITE profilePS5129413.09562122IPR017930Myb domain
SuperFamilySSF466892.51E-1764120IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-2465120IPR006447Myb domain, plants
PfamPF002491.0E-867118IPR001005SANT/Myb domain
PfamPF143798.2E-27163209IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009567Biological Processdouble fertilization forming a zygote and endosperm
GO:0010628Biological Processpositive regulation of gene expression
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MYSSARMPIV QTLPLEAASG GGAGAGAGGG DYHIHHHHHH GGPGMSLDGT NLPGDACLVL  60
TTDPKPRLRW TAELHERFVD AVTQLGGPDK ATPKTIMRTM GVKGLTLYHL KSHLQKYRLG  120
KQACKETTEN SKDASCVAES QDTGSSTCAS SRMIAQDIND GYQVTEALRV QMEVQRRLHE  180
QLEVQRRLQL RIEAQGKYLQ SILEKACKAL NDHAVASAGL EAAREELSEL AIKVASDCQG  240
MTSVPPLSEV APGMENKTPS NLPARIGDCS IDSCLTSNES PVSPVGDGSQ AAALKKRARP  300
VFGNRESLHF DNSMRQVEWM MTNIG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A5e-1965121157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-1965121157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-1965121157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-1965121157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Probable component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). Required for female gametophyte development and function (PubMed:15634699). {ECO:0000269|PubMed:15634699, ECO:0000269|PubMed:26586833}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027116786.10.0protein PHR1-LIKE 3-like
SwissprotQ8LAJ71e-129PHL3_ARATH; Protein PHR1-LIKE 3
TrEMBLA0A068TU040.0A0A068TU04_COFCA; Uncharacterized protein
STRINGXP_006493809.11e-165(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37912344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.11e-119G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]