PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc03_g03300
Common NameGSCOC_T00026014001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family GRAS
Protein Properties Length: 475aa    MW: 52927.4 Da    PI: 7.2939
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc03_g03300genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS272.81.1e-831054734374
         GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalkl.fsev...sPilkfshl 96 
                  lL ++A  +s++++  a++lL+  ++ as +g+p+qR++ yf+eAL+++++  ++ e+ +  p  + ++ +++e++ +l+  + e+    P+ +++++
  Cc03_g03300 105 LLQAAAFNFSNQQFVHARNLLNICQDSASLNGNPIQRVVYYFVEALQEKITMeTGGEVLQEKPEGNRRDLTVEEAFLSLHPaLMEChakLPFCRITQF 202
                  344555567888888************************************944445554444444443333333333322565552237******** PP

         GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlelee 193
                  ta qaIl+ v +++r+H iD++i+ G+QW  L+qaLa+R e p   l+iT+vg+    ske++ee+g++L++fA++l++pf f++ v+++l++++   
  Cc03_g03300 203 TAIQAILDNVGSAKRIHLIDLGIKCGTQWSVLMQALANRHECPLeLLKITAVGP----SKEMIEEIGKQLSSFAASLNIPFAFRI-VVSDLQNVDQYL 295
                  ****************************************6665499*******....**************************9.7999******** PP

         GRAS 194 LrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellg 291
                  +++  +E++a+ + l++ +ll+ +++les    +L+++k+l+P+v+v++e ea++n++ F++rf  +l++ +alfd+le+ + r+s  r+ +E ++l+
  Cc03_g03300 296 FQLAANEVVAIYSELRMASLLAWPHHLES----LLSTIKKLRPRVMVMIEIEANTNAPLFMDRFNASLSVSAALFDCLESCMDRDSPCRAIIEGMFLR 389
                  *********************99999999....***************************************************************** PP

         GRAS 292 reivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  + i+ +++ +g+e+++r+e+ + Wr+ l+++G+ +++ls+ a +qa+l+ +  + +   ++e + + + +gWk+ p+ ++S+W+
  Cc03_g03300 390 EGIQYLITSRGKESIHRQESIGFWRAFLKRFGMVEIALSNWAFCQANLVAKSNPcWSSCTLEVNGKGMAIGWKGTPIHMLSVWK 473
                  ******************************************************9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.5276452IPR005202Transcription factor GRAS
PfamPF035143.9E-81105473IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MAPQHEEITK GARTTVPISF FAEAKNKNQF LPSASLHLIK KHHESKVMPE QSPTSEPSNI  60
SCSLSLELST VDIIKMAKKI GSGDLSYVKS AASPENYKDF ELALLLQAAA FNFSNQQFVH  120
ARNLLNICQD SASLNGNPIQ RVVYYFVEAL QEKITMETGG EVLQEKPEGN RRDLTVEEAF  180
LSLHPALMEC HAKLPFCRIT QFTAIQAILD NVGSAKRIHL IDLGIKCGTQ WSVLMQALAN  240
RHECPLELLK ITAVGPSKEM IEEIGKQLSS FAASLNIPFA FRIVVSDLQN VDQYLFQLAA  300
NEVVAIYSEL RMASLLAWPH HLESLLSTIK KLRPRVMVMI EIEANTNAPL FMDRFNASLS  360
VSAALFDCLE SCMDRDSPCR AIIEGMFLRE GIQYLITSRG KESIHRQESI GFWRAFLKRF  420
GMVEIALSNW AFCQANLVAK SNPCWSSCTL EVNGKGMAIG WKGTPIHMLS VWKC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-3713147332375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027120841.10.0DELLA protein RGL2-like
TrEMBLA0A068TRX10.0A0A068TRX1_COFCA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA85001728
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.15e-47RGA-like 2