PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc02_g39520
Common NameGSCOC_T00027704001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family ARF
Protein Properties Length: 697aa    MW: 77014.8 Da    PI: 5.9732
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc02_g39520genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B369.74e-22135237198
                  EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE....EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliy..rkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91 
                  f+k+lt sd++++g +++ +k+a+e+     + + + s++l+ +d++g +W++k+i+  + +++r++lt+GW+ Fv +++L +gD +vF +    ++e
  Cc02_g39520 135 FCKILTASDTSTHGGFSVLRKHATEClpqldMTQATPSQDLVAKDLHGYEWRFKHIFrgKCQPRRHLLTTGWSTFVTSKRLVAGDAFVFLR--GGNGE 230
                  99**************************999556667789*****************44444556*************************4..37899 PP

                  .EEEEE- CS
           B3  92 lvvkvfr 98 
                  l+v+++r
  Cc02_g39520 231 LHVGIRR 237
                  9****98 PP

2Auxin_resp98.87.8e-33263342183
   Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                  a+ha+ t++ F v+Y+Pr+  s+F++ ++k+++a+++ +s+GmRfkm+fe+eds+e+r++Gt+vg+++++p +Wp+S+WrsLk
  Cc02_g39520 263 ASHAIITQTLFVVYYKPRT--SQFIIGLNKYLAAVSHGFSLGMRFKMKFEGEDSPEKRFTGTIVGLEEVSP-QWPDSPWRSLK 342
                  6899**************6..9*************************************************.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019367.98E-38126266IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.6E-38128252IPR015300DNA-binding pseudobarrel domain
CDDcd100172.29E-19134237No hitNo description
SMARTSM010194.1E-21135239IPR003340B3 DNA binding domain
PfamPF023626.0E-20135237IPR003340B3 DNA binding domain
PROSITE profilePS5086312.097135239IPR003340B3 DNA binding domain
PfamPF065071.7E-30263342IPR010525Auxin response factor
PfamPF023092.5E-14564665IPR033389AUX/IAA domain
SuperFamilySSF542774.12E-14577657No hitNo description
PROSITE profilePS5174527.384581673IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 697 aa     Download sequence    Send to blast
MAHVDGFRGG ASSAPSHTLP ARDTGQGDDM YTELWKACAG PLVDVPRAGE RVFYFPQGHM  60
EQLEASMNQE LNQQIPQFNL PSKILCKVVN VQLLAEAETD EVYAQITLHP EVNEQEPSSP  120
NPCTPDPPKP TIYSFCKILT ASDTSTHGGF SVLRKHATEC LPQLDMTQAT PSQDLVAKDL  180
HGYEWRFKHI FRGKCQPRRH LLTTGWSTFV TSKRLVAGDA FVFLRGGNGE LHVGIRRLAR  240
QQSPIPQSVI SSQSMHLGVL ATASHAIITQ TLFVVYYKPR TSQFIIGLNK YLAAVSHGFS  300
LGMRFKMKFE GEDSPEKRFT GTIVGLEEVS PQWPDSPWRS LKIQWDEPAS IKRPERVSPW  360
EIEPFAVVSS ADVAAQPVPN SKRPRPLDLP TSENRAIAAA SPFWCPEATQ LLELSHYDNI  420
TEVQSTDDQS FWPPKPKNLN SNIRTGSSFS SRGTWPCPLA NGSLNQENVS AKSHLCDYDS  480
PMSSRASNSH VLGQVERFKR LENSSSCRLF GIDLRSNSKN LSLLDKDGPS TVVPNGANDA  540
EPPVGTSDGD VLKSCNEMKL GQSEVSPKDA QNRQGCSTTT RTRTKVQMQG VAVGRAVDLT  600
ALESYHDLIS ELEKMFELEG ELSPQNKWAV VYTDDEGDMM LVGDDPWPEF CKMVRKIFIY  660
SSEEVKKMSA GDKLPLSTLD GEGTVQSLDS ELKLES*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1712836517355Auxin response factor 1
4ldw_A1e-1712836517355Auxin response factor 1
4ldw_B1e-1712836517355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1381385KRPRP
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027164063.10.0auxin response factor 11
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A068UK570.0A0A068UK57_COFCA; Auxin response factor
STRINGPGSC0003DMT4000003450.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9