PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc02_g15120
Common NameGSCOC_T00013946001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family G2-like
Protein Properties Length: 400aa    MW: 45090.2 Da    PI: 8.3119
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc02_g15120genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.64.3e-3191144255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  prlrWtp+LH +Fv+a+e+LGG+e+AtPk +l+lm+v gL+++hvkSHLQ+YR+
  Cc02_g15120  91 PRLRWTPDLHLSFVHAIERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRS 144
                  8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-2887145IPR009057Homeodomain-like
PROSITE profilePS5129412.00587147IPR017930Myb domain
SuperFamilySSF466894.84E-1490145IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-2291146IPR006447Myb domain, plants
PfamPF002493.8E-892143IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MVEDSDVNAK LKSDRNEDDT AQTSPDSSLN ISSIDLNEEA SSNVDEETSS EVPDLSLVDC  60
EKSSEGNSEN YCTSVERNEK KVRQYNRSKL PRLRWTPDLH LSFVHAIERL GGQERATPKL  120
VLQLMNVRGL SIAHVKSHLQ MYRSKKLDES GQVIGLAKRG MQGKGPFSGR MDQMCSPVEQ  180
FRYQNGAIVV ASNPNGGNNI VNILSNASLQ SPYETKSLSS RFQQWSYYQD SMMKSQGKSC  240
NSSIFHAMHG ATRNGPIRPS SFLEEKRWPP REFSSHHLKE KRVDPTASKW ANAPFQPLYN  300
QFHQPENSAG ATYFMQRANW NRRDSLTAER VETNGNNPAN ILKIESPYRH QMMNEHKILD  360
GKEWSPDLQL SLSRSLGSYK DMAQNKGESD VNTRLSLSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-1792146458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-1792146458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A9e-1892146357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B9e-1892146357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C9e-1892146357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D9e-1892146357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-1792146458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-1792146458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-1792146458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-1792146458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-1792146458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-1792146458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027105537.10.0transcription factor HHO1-like
TrEMBLA0A068TN770.0A0A068TN77_COFCA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA55162334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-37G2-like family protein