PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc02_g14150
Common NameGSCOC_T00013816001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family VOZ
Protein Properties Length: 355aa    MW: 39347.4 Da    PI: 5.927
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc02_g14150genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ420.23.4e-129542731217
          VOZ   1 pppsaflgpkcalwdctrpaqgsewl...qdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaael 95 
                  ppp+aflgpkcalwdc+rpaqgsew+   qdycs +hat+a  eg pg++pvlrp+gi+lkd+llfaalsak+qgk+vgipecegaat+kspwna+el
  Cc02_g14150  54 PPPAAFLGPKCALWDCPRPAQGSEWCqtsQDYCSGYHATIAPAEGYPGMAPVLRPGGIGLKDNLLFAALSAKAQGKDVGIPECEGAATTKSPWNAPEL 151
                  89***********************944459******************************************************************* PP

          VOZ  96 fdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdek 193
                  fdl +lege irewlffdkprrafesgnrkqrslpdy+grgwhes kqvm+e+gglkrsyymdpqp++++ewhlyeyein++d +alyrlelklvd+k
  Cc02_g14150 152 FDLVVLEGEMIREWLFFDKPRRAFESGNRKQRSLPDYTGRGWHESGKQVMNEYGGLKRSYYMDPQPMKNYEWHLYEYEINKYDVCALYRLELKLVDGK 249
                  ************************************************************************************************** PP

          VOZ 194 ksakgkvskdsladlqkklgrlta 217
                  ks+kgk+++ds++dlqk++ +lta
  Cc02_g14150 250 KSPKGKIATDSVTDLQKQMKKLTA 273
                  **********************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MGVNNLGLPT QLEYHTFDLH QDFENQYFQG FDGTGLCGED ALPQIAGFVQ NFCPPPAAFL  60
GPKCALWDCP RPAQGSEWCQ TSQDYCSGYH ATIAPAEGYP GMAPVLRPGG IGLKDNLLFA  120
ALSAKAQGKD VGIPECEGAA TTKSPWNAPE LFDLVVLEGE MIREWLFFDK PRRAFESGNR  180
KQRSLPDYTG RGWHESGKQV MNEYGGLKRS YYMDPQPMKN YEWHLYEYEI NKYDVCALYR  240
LELKLVDGKK SPKGKIATDS VTDLQKQMKK LTAEFPSDKQ RAIKGGAKAA SKDAAGSIYS  300
TPNRMPPTGE GFEYSTGASY EYLVDNLNGY YHCHFTSYIS MSWALSSSGL LSTL*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027105411.10.0transcription factor VOZ1-like
SwissprotQ9SGQ01e-148VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A068TKM70.0A0A068TKM7_COFCA; Uncharacterized protein
STRINGXP_009776508.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28182454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-144vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]