PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc02_g12890
Common NameGSCOC_T00029224001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family Dof
Protein Properties Length: 288aa    MW: 31666.2 Da    PI: 7.7502
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc02_g12890genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof111.44.1e-3544101259
       zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 
                  +++ lkcprC s+ntkfCyynny+ sqPr+fCkaC+r+Wt+GG+lrnvPvGggr++++
  Cc02_g12890  44 QSEPLKCPRCGSSNTKFCYYNNYNKSQPRHFCKACKRHWTNGGTLRNVPVGGGRKNKR 101
                  57889***********************************************976554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-2245101IPR003851Zinc finger, Dof-type
PfamPF027016.8E-3147100IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.22348102IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105086IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MGLNTKQVSS DHPLDWNQTL LDSGAVELPK PPPAKRQQQN QQQQSEPLKC PRCGSSNTKF  60
CYYNNYNKSQ PRHFCKACKR HWTNGGTLRN VPVGGGRKNK RLKTANAATI TTAITTTNTA  120
IRDCHNSPLA TINDQKNISD ILYQALISSS SSVQHDPINA FTSKTSMSNA ITGPMLSLPQ  180
DRHSLQFSFS SLSPFDTIPC SFPCSNLSLN NAYDYTAELD HLESSTVTTV TPSTTSAGVF  240
SQSSWQGQTT NTSSTLAEMP NYWNWNDMDP LVSADLNIPW DDIEIKP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096259.12e-80PREDICTED: dof zinc finger protein DOF1.4-like
TrEMBLA0A068TW620.0A0A068TW62_COFCA; Uncharacterized protein
STRINGPOPTR_0004s03900.12e-76(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61712033
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.21e-28Dof family protein