PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc02_g06210
Common NameGSCOC_T00039146001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family LBD
Protein Properties Length: 176aa    MW: 19360.1 Da    PI: 7.3035
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc02_g06210genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260131.34e-4111109199
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+l+r+C ++C +apyf +++p+kfa vhk+FGasnv+k+l+++pee+red+++slvyeAe+r+rdPvyG++g i +lq+++ +l+++l l+k
  Cc02_g06210  11 SCAACKFLKRRCIPNCQFAPYFRSDEPNKFAKVHKVFGASNVSKILNEVPEEQREDTVNSLVYEAEVRLRDPVYGCIGAIASLQKKMVELQHDLLLAK 108
                  6********************************************************************************************98887 PP

       DUF260  99 e 99 
                  +
  Cc02_g06210 109 A 109
                  6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.58610111IPR004883Lateral organ boundaries, LOB
PfamPF031953.2E-4011107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MKNQEPRSSS SCAACKFLKR RCIPNCQFAP YFRSDEPNKF AKVHKVFGAS NVSKILNEVP  60
EEQREDTVNS LVYEAEVRLR DPVYGCIGAI ASLQKKMVEL QHDLLLAKAR LAYCATTKPA  120
PTSAIFLEGP SNVASNIDFP ASAGLELEEA FYHNSSVMGQ NANGWMNELG QFPLV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009786680.18e-79PREDICTED: LOB domain-containing protein 21-like
RefseqXP_016497209.11e-78PREDICTED: LOB domain-containing protein 21-like
SwissprotQ9SRL81e-63LBD21_ARATH; LOB domain-containing protein 21
TrEMBLA0A068UZL31e-129A0A068UZL3_COFCA; Uncharacterized protein
STRINGSolyc03g095940.1.13e-74(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11090.18e-65LOB domain-containing protein 21