PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc02_g00930
Common NameGSCOC_T00019895001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family GRF
Protein Properties Length: 591aa    MW: 62415.8 Da    PI: 6.5458
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc02_g00930genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC74.21.4e-23240283245
          WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                   epgrC+RtDGKkWRCsr+v + +k+CErH+hrgr rsrk++e+
  Cc02_g00930 240 LEPGRCKRTDGKKWRCSRDVAPHQKYCERHMHRGRPRSRKPVEQ 283
                  69**************************************9985 PP

2QLQ52.61.4e-18178210234
          QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqa 34 
                  +FTa Q+ +L++Q+++yKy++a++PvP++Ll++
  Cc02_g00930 178 PFTAVQWKELERQAMIYKYMIASVPVPSDLLLP 210
                  8******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.9E-11177213IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.23178213IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.3E-12178210IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.358239283IPR014977WRC domain
PfamPF088791.8E-19241282IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 591 aa     Download sequence    Send to blast
MEESSSSSSS SAGIITTASH RTQSFPSNNS VMDHHHRPLL SSANGADDDD EEDDGGGRGS  60
GRSQNDSGPN EVERSPAPTP TPTPKPPNYS CHHSSSTGPS RTSSSSATTT STSTGIVFPD  120
RVVVVTNNGS ATAGLAAAAA ATTLQPFDFP CSITNTASKS PGGGGLGMAA ASAALGFPFT  180
AVQWKELERQ AMIYKYMIAS VPVPSDLLLP ADPTAAPLLL GGSHGGGGSI YNLRYGNRDL  240
EPGRCKRTDG KKWRCSRDVA PHQKYCERHM HRGRPRSRKP VEQLQSSSVS PDDNPNNNIS  300
KKSRLHHTSL HPNPTVAQPD NHSSPQFQGT GTIQQLKDPQ LLDASIAFNS IFASSCNYKE  360
SNRVFGWAVD GEVMAANRVE QESLHLMDTR RREGLAPIRG YIYGTNASTL QQGYGEEGPL  420
NLFSYATEIA YPGGIHSRND EHYHAFLNSD LIASKQPQMD QHWNGLSPSS LPLSMAMAAG  480
NALDEGTGLA EDSHPRMPTP KDSPVSWLPL IPGGPLAEVL QPNSVACGSN PASPYASNGD  540
SVSPPATTVS SPTGIFQRAL FSHSDGSVCN SPALAASAAP PEVVAFQWLN *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027161232.10.0growth-regulating factor 8-like isoform X2
TrEMBLA0A068U9X50.0A0A068U9X5_COFCA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA70322230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.16e-31growth-regulating factor 2