PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc01_g18220
Common NameGSCOC_T00016231001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family NAC
Protein Properties Length: 300aa    MW: 33359.1 Da    PI: 6.2357
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc01_g18220genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.29.9e-51101381129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lppGfrF P+deelv++yL kk+++ +++  +++ e+d++++ePw+Lp  +k +++ewyfFs rd+kyatg r+nrat++gyWkatgkd++vl+  ++
  Cc01_g18220  10 LPPGFRFYPSDEELVCHYLYKKIANGEVSR-DTLVEIDLHTCEPWQLPDVAKLNSNEWYFFSFRDRKYATGFRTNRATTTGYWKATGKDRTVLDPtRR 106
                  79*************************999.88***************87778899**************************************9777 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrle 129
                  + vg++ktLvfy++rap+g kt W+mhe+rle
  Cc01_g18220 107 SIVGMRKTLVFYRNRAPNGIKTGWIMHEFRLE 138
                  88***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.1E-618156IPR003441NAC domain
PROSITE profilePS5100557.87410156IPR003441NAC domain
PfamPF023652.3E-2711137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MGLRDIGATL PPGFRFYPSD EELVCHYLYK KIANGEVSRD TLVEIDLHTC EPWQLPDVAK  60
LNSNEWYFFS FRDRKYATGF RTNRATTTGY WKATGKDRTV LDPTRRSIVG MRKTLVFYRN  120
RAPNGIKTGW IMHEFRLENP HVPPKEDWVL CRVFHKAKVE SVDNDVYDAT AGGGCGGGGD  180
ISPTFAASPP NVDHCTAGGY NQNSSFSQSP PHQSQNSSST AALPNMSAVL GRNYLQSSSQ  240
ELCSVTASRN DQMVHSKSEL DEYGFLFNMN FGEANLRDGG VPSGLEEMHF DDDSSLVFI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-48915616165NO APICAL MERISTEM PROTEIN
1ut4_B1e-48915616165NO APICAL MERISTEM PROTEIN
1ut7_A1e-48915616165NO APICAL MERISTEM PROTEIN
1ut7_B1e-48915616165NO APICAL MERISTEM PROTEIN
3swm_A2e-48915619168NAC domain-containing protein 19
3swm_B2e-48915619168NAC domain-containing protein 19
3swm_C2e-48915619168NAC domain-containing protein 19
3swm_D2e-48915619168NAC domain-containing protein 19
3swp_A2e-48915619168NAC domain-containing protein 19
3swp_B2e-48915619168NAC domain-containing protein 19
3swp_C2e-48915619168NAC domain-containing protein 19
3swp_D2e-48915619168NAC domain-containing protein 19
4dul_A1e-48915616165NAC domain-containing protein 19
4dul_B1e-48915616165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027094925.10.0protein CUP-SHAPED COTYLEDON 2-like isoform X1
SwissprotQ84TE65e-63NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A068U6G40.0A0A068U6G4_COFCA; Uncharacterized protein
STRINGEOX944241e-124(Theobroma cacao)
STRINGXP_009800923.11e-124(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18822466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.13e-90NAC domain containing protein 74
Publications ? help Back to Top
  1. Le Hénanff G, et al.
    Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance.
    J. Exp. Bot., 2013. 64(16): p. 4877-93
    [PMID:24043850]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  4. Huo X,Wang C,Teng Y,Liu X
    Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
    BMC Plant Biol., 2015. 15: p. 266
    [PMID:26530097]
  5. Chen X, et al.
    Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis.
    Plant Physiol., 2016. 170(4): p. 2136-45
    [PMID:26850273]
  6. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]