PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc01_g14740
Common NameGSCOC_T00028484001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family LBD
Protein Properties Length: 166aa    MW: 18226 Da    PI: 7.2064
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc01_g14740genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.42.9e-4461051100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +Ca+Ck+lrr+CakdC++apyfp ++p+kfa+vhk+FGasnv+k+l++lp ++r da+ slvyeA+ar+rdPvyG+vg i+ lq+q++ql+ +la+++
  Cc01_g14740   6 PCASCKLLRRRCAKDCIFAPYFPPDDPHKFAIVHKVFGASNVSKMLQELPVQQRADAVGSLVYEANARMRDPVYGCVGAISYLQNQVSQLQMQLAVAQ 103
                  7***********************************************************************************************99 PP

       DUF260  99 ee 100
                  +e
  Cc01_g14740 104 AE 105
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.7575106IPR004883Lateral organ boundaries, LOB
PfamPF031957.6E-446103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MGGSSPCASC KLLRRRCAKD CIFAPYFPPD DPHKFAIVHK VFGASNVSKM LQELPVQQRA  60
DAVGSLVYEA NARMRDPVYG CVGAISYLQN QVSQLQMQLA VAQAEILCIQ MQQQEPAALP  120
TQLDVPDEKS LLLSTSTFNN LQPYLSFASS STVMQDPLKR ESLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002278121.21e-104PREDICTED: LOB domain-containing protein 12
SwissprotQ8LBW31e-79LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A068ULU31e-120A0A068ULU3_COFCA; Uncharacterized protein
STRINGVIT_06s0004g07200.t011e-104(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-77LBD family protein