PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc01_g12690
Common NameGSCOC_T00028211001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family WOX
Protein Properties Length: 238aa    MW: 26882.3 Da    PI: 8.8362
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc01_g12690genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.22.2e-211978357
                 --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                 +R+++tkeq++ Le+l+++  r+psae++++++++l    +++ ++V++WFqN++a++++
  Cc01_g12690 19 SRWNPTKEQIDMLESLYKQgLRTPSAEQIQQITNRLraygHIEGKNVFYWFQNHKARQRQ 78
                 6*****************99**************************************97 PP

2Wus_type_Homeobox115.82.1e-371880365
  Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                        +RW+Pt+eQi +Le+lyk+GlrtP++e+iq+it++L++yG+ie+kNVfyWFQN+kaR+rqkq
        Cc01_g12690 18 GSRWNPTKEQIDMLESLYKQGLRTPSAEQIQQITNRLRAYGHIEGKNVFYWFQNHKARQRQKQ 80
                       58***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.9651479IPR001356Homeobox domain
SMARTSM003892.3E-61683IPR001356Homeobox domain
SuperFamilySSF466898.55E-131884IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.0E-91978IPR009057Homeodomain-like
PfamPF000464.1E-191978IPR001356Homeobox domain
CDDcd000864.48E-72080No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MESHDNLDMP ISGGAPVGSR WNPTKEQIDM LESLYKQGLR TPSAEQIQQI TNRLRAYGHI  60
EGKNVFYWFQ NHKARQRQKQ KQDHVSPFNR FLHKTASVLP PCTNVLCSPY YMPYPETGLC  120
HQQQQLSKVL LPRSFKRRPI LPEKLEKSKL LECVMSNSKQ FNQETLDLFP QQPTGTLQSR  180
TAAAVASCSF PSNYFGYSTA TPSTSSATRS FTDKGGYDDH HPFFDFLCGN NGSCDGH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027126371.11e-175WUSCHEL-related homeobox 2-like
TrEMBLA0A068UL491e-179A0A068UL49_COFCA; Uncharacterized protein
STRINGXP_009758504.17e-71(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA114141925
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.11e-50WUSCHEL related homeobox 2