PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc01_g11610
Common NameGSCOC_T00028065001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family LBD
Protein Properties Length: 207aa    MW: 22371.3 Da    PI: 7.2709
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc01_g11610genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.63.6e-42401391100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca++Cvlapyfp ++p kf  +h++FGasn++k+l++lpe++r da+ss+vyeA+ar+rdPvyG++g i +lq+q++ l+a+la+++
  Cc01_g11610  40 PCAACKILRRRCAEKCVLAPYFPPNDPIKFTTAHRVFGASNIIKFLQELPESQRADAVSSMVYEANARLRDPVYGSAGAICQLQKQVNDLQAQLAKTQ 137
                  7***********************************************************************************************99 PP

       DUF260  99 ee 100
                  +e
  Cc01_g11610 138 AE 139
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.10539140IPR004883Lateral organ boundaries, LOB
PfamPF031956.0E-4240137IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MGYSDTTTAT TITSKSSRSV SPSSPSSPPT PPPPAVVVSP CAACKILRRR CAEKCVLAPY  60
FPPNDPIKFT TAHRVFGASN IIKFLQELPE SQRADAVSSM VYEANARLRD PVYGSAGAIC  120
QLQKQVNDLQ AQLAKTQAEL VNMQCQQANL MALICMEMAQ SPQASSPQQQ SFDNNFINSS  180
SQLAAFQANL NLLDDSHPWD HPALWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009610820.12e-91PREDICTED: LOB domain-containing protein 1-like
RefseqXP_016509518.12e-91PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9SK082e-70LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A068UL041e-151A0A068UL04_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000653463e-88(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-64LOB domain-containing protein 1