PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc01_g10750
Common NameGSCOC_T00024181001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family TCP
Protein Properties Length: 200aa    MW: 21722.4 Da    PI: 10.9053
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc01_g10750genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP58.72.4e-1881148673
          TCP   6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                  d  sk   k    + RvRl+a+caar+F+L++eLG+ ++++t+eWLl++        t+++  +++++
  Cc01_g10750  81 DGRSKNKLKATRGGHRVRLPALCAARIFQLTRELGHRTNGQTVEWLLRNVHLPSASETSSTVVASNSS 148
                  666777777777789*********************************99877666666645444444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS513699.75179137IPR017887Transcription factor TCP subgroup
PfamPF036344.1E-1494129IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MAPPFTTTPP APLPMTATAT KYYFTTISNN GGVSTPPSFS TQEGQLTKPR SIQLAPSSPF  60
RSSEQKRRRR TNSNNEHGKG DGRSKNKLKA TRGGHRVRLP ALCAARIFQL TRELGHRTNG  120
QTVEWLLRNV HLPSASETSS TVVASNSSPT TAWSQFPKQE PYEIFPAEGG GLFDTMSFTS  180
LLMQAAKRGG EVNDVVFDP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019188972.17e-21PREDICTED: transcription factor PCF1-like
TrEMBLA0A068UES71e-144A0A068UES7_COFCA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24824201
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47620.13e-16TEOSINTE BRANCHED, cycloidea and PCF (TCP) 14