PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc01_g07010
Common NameGSCOC_T00030116001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family GRAS
Protein Properties Length: 530aa    MW: 59541.4 Da    PI: 5.9656
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc01_g07010genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS261.1e-08214268155
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar 55 
                  lv+ Ll +Ae+v ++++ la+ l++r   +as +g++ qR++++f+eAL++r+  
  Cc01_g07010 214 LVQFLLIAAECVGHKKFDLASGLITRCLCIASDSGNAAQRIVFHFAEALQHRIDI 268
                  57899***********************************************975 PP

2GRAS214.36.3e-66279527119374
         GRAS 119 isqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrllde 216
                  i+ G+QW  L+qaL +R+ + p l iT+vg     +k+++eetg+rL +fA++l+++++fnv++++++e+l+ ++L+  p+Ea+aV + l l ++ ++
  Cc01_g07010 279 IERGVQWTVLMQALVERD-DRPALTITAVGT---MNKQRMEETGKRLISFAQSLNLSLSFNVVMVSDMEELKEDMLSKAPDEAVAVYSPLILRTMISK 372
                  789**************5.569*********...67************************************************************99 PP

         GRAS 217 svsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlek 314
                  + sl++    v+k++++++P vvvv+e ea+hns+ F  rf+e+l +ysa+fd+le  + r++e+r+++E  +lg+ i+n+v  eg++r  r+     
  Cc01_g07010 373 PESLRN----VIKVIRRMKPAVVVVTEVEANHNSPLFISRFTESLFFYSAFFDCLEDCMERNNEHRKTIEGIYLGEGIRNMVGSEGDKRCTRNVMIDV 466
                  999999....**************************************************************************************** PP

         GRAS 315 WrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  Wre +++ G+ +v+ls++  +qa+++l+k++     ++ +  + +v+gWk+ p+ s++ W+
  Cc01_g07010 467 WREFFTRYGMVEVELSHSSLQQANMILKKFHkASSCNLINAGKGIVIGWKGTPIHSLTTWK 527
                  *******************************88889999*********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF035143.8E-6214268IPR005202Transcription factor GRAS
PROSITE profilePS5098527.386279506IPR005202Transcription factor GRAS
PfamPF035142.2E-63279527IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 530 aa     Download sequence    Send to blast
MEDYEADEQE ANGGKTQRQP PQPPDTDWFN VEDNSLYGLY QQQNNPTPSK VAFLEGGQQA  60
TSTPPQFNWV QNDFQHLVST PALHSFQPIY DQATAKNNEQ PQQQLLPETG GKWQQLKGKT  120
HSFTLASLEL LSNYGKGFKN AAREDQNWSN DSPTNIDQDS SQGRRLSLGE IIRAAGERYI  180
QFSTKNVDGF SGLIHPYASA ITDISVAETA DVELVQFLLI AAECVGHKKF DLASGLITRC  240
LCIASDSGNA AQRIVFHFAE ALQHRIDIQT GKITPERIIE RGVQWTVLMQ ALVERDDRPA  300
LTITAVGTMN KQRMEETGKR LISFAQSLNL SLSFNVVMVS DMEELKEDML SKAPDEAVAV  360
YSPLILRTMI SKPESLRNVI KVIRRMKPAV VVVTEVEANH NSPLFISRFT ESLFFYSAFF  420
DCLEDCMERN NEHRKTIEGI YLGEGIRNMV GSEGDKRCTR NVMIDVWREF FTRYGMVEVE  480
LSHSSLQQAN MILKKFHKAS SCNLINAGKG IVIGWKGTPI HSLTTWKFM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-2623252721375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027172080.10.0DELLA protein RGL1-like
TrEMBLA0A068UMG50.0A0A068UMG5_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000187921e-147(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46941842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.12e-44GRAS family protein