PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc01_g04350
Common NameGSCOC_T00004456001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family LBD
Protein Properties Length: 177aa    MW: 19339.9 Da    PI: 8.3902
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc01_g04350genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260146.67.1e-46131121100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+CakdCv+apyfpa++p+kfa vhk+FGasnv k+l++lpe++r da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+++lal++
  Cc01_g04350  13 PCAACKLLRRRCAKDCVFAPYFPADEPQKFASVHKVFGASNVNKMLQELPEHQRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDVLQTQLALAQ 110
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  Cc01_g04350 111 AE 112
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.07812113IPR004883Lateral organ boundaries, LOB
PfamPF031953.1E-4513110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MKENSRKQGA ASPCAACKLL RRRCAKDCVF APYFPADEPQ KFASVHKVFG ASNVNKMLQE  60
LPEHQRGDAV SSMVYEANAR VRDPVYGCVG AISSLQQQID VLQTQLALAQ AEVVQMRMRQ  120
FSSISPGTAT NSPDHNNITS PSSSRHTQSH HDRTSLFAMG MVIDHQASMG ESLWSC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016493640.14e-98PREDICTED: LOB domain-containing protein 4-like
RefseqXP_009603165.14e-98PREDICTED: LOB domain-containing protein 4-like
SwissprotQ9SHE93e-77LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A068VA161e-131A0A068VA16_COFCA; Uncharacterized protein
STRINGSolyc11g045530.1.14e-97(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.12e-78LOB domain-containing protein 4