PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc00_g31280
Common NameGSCOC_T00006997001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family bHLH
Protein Properties Length: 175aa    MW: 19722.2 Da    PI: 10.3998
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc00_g31280genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH30.28.3e-101664654
                 HHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
          HLH  6 nerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                 +  Er+RR r++s++ eL +l+P+++++++++ls  + L +++ YI +L
  Cc00_g31280 16 KTTERNRRIRMKSSILELISLVPQQFNPSKERLSPKDQLHRVTAYITQL 64
                 568*********************99999999***************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088810.0171064IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.102.8E-81083IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474593.27E-101482IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000103.1E-61764IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000832.89E-41969No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MESYNASDAT TKLDRKTTER NRRIRMKSSI LELISLVPQQ FNPSKERLSP KDQLHRVTAY  60
ITQLRERVEK LKKMKEMLIS KFNTSGIPGS GIPVVKITEI GSNLEVVLVT GLSKKFGLHE  120
VILVLHGQGV EVVSISISTM ADRIYHILHA QVKMPRIGVD TLIIYDRLQK LCLD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002322161.16e-51hypothetical protein POPTR_0015s08580g
TrEMBLA0A068VMG41e-124A0A068VMG4_COFCA; Uncharacterized protein
STRINGPOPTR_0015s08580.12e-50(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA60831423
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G20970.13e-21bHLH family protein