PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10033956m
Common NameCICLE_v10033956mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family LBD
Protein Properties Length: 187aa    MW: 20604.6 Da    PI: 6.479
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10033956mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.68.7e-43291281100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe++r da+ss+vyeA ar+rdPvyG++g i +lq+q+++l+a+l
  Ciclev10033956m  29 PCAACKILRRRCVEKCVLAPYFPPTEPYKFTIAHRVFGASNIIKFLQELPESQRADAVSSMVYEASARIRDPVYGCAGAICHLQKQVSELQAQL 122
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      a++++e
  Ciclev10033956m 123 AKAQAE 128
                      **9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.07728129IPR004883Lateral organ boundaries, LOB
PfamPF031956.4E-4329126IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
SSPSFKASPS QSSPNLAAPL SPPPIVLSPC AACKILRRRC VEKCVLAPYF PPTEPYKFTI  60
AHRVFGASNI IKFLQELPES QRADAVSSMV YEASARIRDP VYGCAGAICH LQKQVSELQA  120
QLAKAQAELV TMESQQRNLI TLICMEMAQS QEQVLQQQQQ QQQQFMDTSC FLDDNGIGSA  180
WEPLWT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-43171301112LOB family transfactor Ramosa2.1
5ly0_B5e-43171301112LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006436214.21e-134LOB domain-containing protein 1
RefseqXP_006485928.11e-134LOB domain-containing protein 1 isoform X2
SwissprotQ9LQR08e-75LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A067E1551e-133A0A067E155_CITSI; Uncharacterized protein
TrEMBLA0A2H5NZ661e-133A0A2H5NZ66_CITUN; Uncharacterized protein
TrEMBLV4VB101e-133V4VB10_9ROSI; Uncharacterized protein (Fragment)
STRINGXP_006485928.11e-134(Citrus sinensis)
STRINGXP_006436214.11e-134(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.15e-64LOB domain-containing protein 1