PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10032782m
Common NameCICLE_v10032782mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family LBD
Protein Properties Length: 202aa    MW: 22415.6 Da    PI: 6.8765
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10032782mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.64.4e-43421411100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+C+++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe +r da++s+vyeA+ r+rdPvyG++gv+ +lq+q+++l+ael
  Ciclev10032782m  42 PCAACKILRRRCVEKCVLAPYFPPTEPQKFVIAHRVFGASNIIKFLQELPEPQRADAVTSMVYEANSRIRDPVYGCAGVVCHLQKQVSELQAEL 135
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      a++++e
  Ciclev10032782m 136 AKAQAE 141
                      **9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.07741142IPR004883Lateral organ boundaries, LOB
PfamPF031956.9E-4342139IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MQITQQYSTP SFSSPRSINA SSSQSSPSFA TPPSPPSIVL SPCAACKILR RRCVEKCVLA  60
PYFPPTEPQK FVIAHRVFGA SNIIKFLQEL PEPQRADAVT SMVYEANSRI RDPVYGCAGV  120
VCHLQKQVSE LQAELAKAQA ELASMQSQQQ NLIALICMEM AQSQEQVLHR HQQQQPPQQF  180
IDTSCFLDEY SLGSTWEPLW T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-424114210111LOB family transfactor Ramosa2.1
5ly0_B9e-424114210111LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006436215.11e-146LOB domain-containing protein 1
SwissprotQ9LQR05e-70LBD1_ARATH; LOB domain-containing protein 1
TrEMBLV4TCY41e-144V4TCY4_9ROSI; Uncharacterized protein
STRINGXP_006436215.11e-145(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-60LOB domain-containing protein 1