PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10032772m
Common NameCICLE_v10032772mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family LBD
Protein Properties Length: 204aa    MW: 22331.5 Da    PI: 7.1948
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10032772mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.51.5e-40431421100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk lrr+C ++Cvlapyfp ++p++f +vh++FGasn++k l+ lpe +r+da+ss+vyeA+ar+r+Pv+G++g i++lq+q+ +l+ael
  Ciclev10032772m  43 PCAACKSLRRRCDEKCVLAPYFPPTEPQNFIIVHRVFGASNIIKCLQGLPECQRSDAVSSMVYEANARIRNPVHGCAGAISQLQKQVIKLQAEL 136
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      a++++e
  Ciclev10032772m 137 AKAQAE 142
                      *99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.55842143IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-4043140IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MHTTFPPLSS SPSPSFQSSP SINASPSKSS PNLAAPPPIV LSPCAACKSL RRRCDEKCVL  60
APYFPPTEPQ NFIIVHRVFG ASNIIKCLQG LPECQRSDAV SSMVYEANAR IRNPVHGCAG  120
AISQLQKQVI KLQAELAKAQ AETVSMQCQR DNLVALICKE MTTQFPQETM NRVLPQQQFN  180
DDDATTCYLD DKDFASTWDA LWT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-40381486116LOB family transfactor Ramosa2.1
5ly0_B1e-40381486116LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006436216.21e-150LOB domain-containing protein 1
RefseqXP_015388139.11e-150LOB domain-containing protein 1-like
SwissprotQ9LQR09e-63LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A067DNZ21e-148A0A067DNZ2_CITSI; Uncharacterized protein
TrEMBLV4TI951e-148V4TI95_9ROSI; Uncharacterized protein
STRINGXP_006486488.11e-149(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.19e-65LOB domain-containing protein 1