PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10032684m
Common NameCICLE_v10032684mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family LBD
Protein Properties Length: 226aa    MW: 24550.8 Da    PI: 8.5666
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10032684mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.71.7e-42421421101
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l+++pe++r da++slvyeA++r+rdPvyG++g i++lqqq+++l+ael
  Ciclev10032684m  42 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKMLNDVPESQRADAANSLVYEANVRLRDPVYGCMGAISTLQQQVQCLQAEL 135
                      7********************************************************************************************* PP

           DUF260  95 allkeel 101
                      +++++e+
  Ciclev10032684m 136 NVVRNEI 142
                      **99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.0341142IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-4242139IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MSRERERFDE IGKKIKREAD ASSHMGRRHM LGPPGTLNTI TPCAACKLLR RRCAQECPFS  60
PYFSPHEPQK FASVHKVFGA SNVSKMLNDV PESQRADAAN SLVYEANVRL RDPVYGCMGA  120
ISTLQQQVQC LQAELNVVRN EIIKYKYREA SNVMPSSHHP HQVALLSSGA VTVAAAPSPS  180
LHTPPPPPPP LPCTPSCSSS IYAQPNTSAA DYSTISGDQN VSYFG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-45341533122LOB family transfactor Ramosa2.1
5ly0_B3e-45341533122LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006435864.11e-167LOB domain-containing protein 15
RefseqXP_006486213.11e-167LOB domain-containing protein 15
SwissprotQ8L5T57e-88LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A2H5NK521e-166A0A2H5NK52_CITUN; Uncharacterized protein
TrEMBLV4VA331e-166V4VA33_9ROSI; Uncharacterized protein
STRINGXP_006486213.11e-167(Citrus sinensis)
STRINGXP_006435864.11e-167(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19272781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.19e-89LOB domain-containing protein 15
Publications ? help Back to Top
  1. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]