PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10032076m
Common NameCICLE_v10032076mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family bZIP
Protein Properties Length: 332aa    MW: 36988.2 Da    PI: 5.4257
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10032076mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.44.2e-10130185560
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                      kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l   +     l 
  Ciclev10032076m 130 KRAKRILANRQSAARSKERKARYISELERKVQTLQTEATTLSAQLTLFQRDTTDLS 185
                      9*****************************************99887766666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.2E-16126190IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.795128191IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.44E-11130182No hitNo description
PfamPF001706.1E-9130187IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.0E-10130185No hitNo description
CDDcd147031.58E-24131180No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MESQDPPNPN PNPPTRGPYH RRSQSEVQYR IPDDMDLVSD PISDPLFDGP GGSEDDLFCS  60
YMDMDKIGSK PTGDDPKHEN ANVSVGARPR HRYSNSIDGT TSSSSVLESI EAKKAMDPDK  120
LAELWTVDPK RAKRILANRQ SAARSKERKA RYISELERKV QTLQTEATTL SAQLTLFQRD  180
TTDLSTENTE LKLRLQAMEQ QAQLRDALNE ALKKEVERLK VATGEMMTPT DTYNLGMQPI  240
PYNQSLFYPH HPQTGPGDTQ IIQLPEFHPF QPNMSTPHQP MLATANSHTF SEMLQQDPLG  300
RLQGLDINGR NSHLVKSEGP SISASESSST F*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Strongly expressed in mature pollen. {ECO:0000269|PubMed:27896439}.
Functional Description ? help Back to Top
Source Description
UniProtTranscrition factor that may participate with bZIP34 in the gametophytic control of pollen development. {ECO:0000269|PubMed:27896439}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00303DAPTransfer from AT2G40620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006435914.10.0bZIP transcription factor 18
RefseqXP_006486172.10.0bZIP transcription factor 18
SwissprotO228731e-118BZP18_ARATH; bZIP transcription factor 18
TrEMBLA0A2H5PNM60.0A0A2H5PNM6_CITUN; Uncharacterized protein
TrEMBLV4VAB20.0V4VAB2_9ROSI; Uncharacterized protein
STRINGXP_006486172.10.0(Citrus sinensis)
STRINGXP_006435914.10.0(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40422757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.11e-113bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Pawar V, et al.
    A novel family of plant nuclear envelope-associated proteins.
    J. Exp. Bot., 2016. 67(19): p. 5699-5710
    [PMID:27630107]
  3. Gibalová A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  5. Babiychuk E,Fuangthong M,Van Montagu M,Inzé D,Kushnir S
    Efficient gene tagging in Arabidopsis thaliana using a gene trap approach.
    Proc. Natl. Acad. Sci. U.S.A., 1997. 94(23): p. 12722-7
    [PMID:9356517]