PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10030900m
Common NameCICLE_v10030696mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family ARF
Protein Properties Length: 666aa    MW: 74664.9 Da    PI: 7.1059
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10030900mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B356.74.3e-188713499
                     SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
               B3 34 ktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                     ++l  +d++g++W++++i+r++++r++l++GW+ Fv++++L +gD ++F   + +++el+v+v+r+
  Ciclev10030900m  8 QELAAKDLHGNEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFL--RGENGELRVGVRRA 71
                     48999*********************************************..449999*****996 PP

2Auxin_resp124.48.1e-4196178183
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                      a+ha+st+++F+v+Y+Pr+s+seF+v+++++++++k+++s+GmRfkm+fe+e+++e+r++Gt+vg++d+dp rW++SkWr+Lk
  Ciclev10030900m  96 AWHAVSTGTMFTVYYKPRTSPSEFIVPYDQYMESIKNNYSIGMRFKMRFEGEEAPEQRFTGTIVGIEDADPQRWRDSKWRCLK 178
                      89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010190.0013172IPR003340B3 DNA binding domain
PROSITE profilePS5086312.464172IPR003340B3 DNA binding domain
SuperFamilySSF1019361.96E-22299IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.6E-26285IPR015300DNA-binding pseudobarrel domain
CDDcd100171.46E-13570No hitNo description
PfamPF023629.8E-16771IPR003340B3 DNA binding domain
PfamPF065075.1E-3896178IPR010525Auxin response factor
PfamPF023097.1E-12521624IPR033389AUX/IAA domain
SuperFamilySSF542777.85E-12539617No hitNo description
PROSITE profilePS5174526.393540633IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009737Biological Processresponse to abscisic acid
GO:0009911Biological Processpositive regulation of flower development
GO:0010047Biological Processfruit dehiscence
GO:0010150Biological Processleaf senescence
GO:0010227Biological Processfloral organ abscission
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 666 aa     Download sequence    Send to blast
MSRQPPTQEL AAKDLHGNEW RFRHIFRGQP RRHLLQSGWS VFVSSKRLVA GDAFIFLRGE  60
NGELRVGVRR AMRQQGNVPS SVISSHSMHL GVLATAWHAV STGTMFTVYY KPRTSPSEFI  120
VPYDQYMESI KNNYSIGMRF KMRFEGEEAP EQRFTGTIVG IEDADPQRWR DSKWRCLKVR  180
WDETSTIPRP ERVSPWKIEP ALAPPALNSL PMPRPKRPRS NMLPSSPDSS VLTREGSSKL  240
NVDPSSATGF SRVLQGQEFS TLRGNFAERE SNESDTAEKS VVWPPSLDDE KIDVVSASRR  300
YGSENWVPPG RHEPVYTDLL SGFGANADPS HGFSSPFADA VPVRKSVLDQ EGKFNLVARP  360
WSLMPSGPSL KMPESNAKVP VQGGDVNYQV RGNVRYGGFG DYPMLNGNRV EHSHGNWLMP  420
PLPPSNFENS AHSRELMPKS AMVQDQEAGK SKDCKLFGIP LFSNHVMPEP VVSHRNTMND  480
PAGNLDQQFR AFESDQKSDH SKSSKLADDN QVFNEHEKLS QPSQTHTKDV RSKTQCGSTR  540
SCTKVQKQGI ALGRSVDLSK FNNYDELIAE LDQLFEFDGE LMAPKKNWII VYTDDEGDMM  600
LVGDDPWQEF CGMVRKIFIY TKEEVLKMNS VSFSSKGEDS PMNGDGIDAK EVKQPLPLAS  660
NAENF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-1021200155354Auxin response factor 1
4ldw_A1e-1021200155354Auxin response factor 1
4ldv_A1e-1021200155354Auxin response factor 1
4ldx_B1e-1021200155354Auxin response factor 1
4ldx_A1e-1021200155354Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ccl.28190.0fruit
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00574DAPTransfer from AT5G62000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN6005200.0JN600520.1 Citrus sinensis auxin-response factor (ARF) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006436945.10.0hypothetical protein CICLE_v10030696mg
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLV4TF440.0V4TF44_9R
STRINGVIT_17s0000g00320.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2