PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10030751m
Common NameCICLE_v10030751mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family ARF
Protein Properties Length: 784aa    MW: 87956.5 Da    PI: 4.9168
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10030751mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B352.49.5e-17161261198
                      EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                      f k+l  sd +k++ +v+  k ae+        ++kk+ +  ++ +d +g  W++++ +++ks+r++lt GWk Fv++++L  gD+v+F +  +
  Ciclev10030751m 161 FYKKLRASDQSKKK-IVIRAKDAENVfpflahlDYKKQINYSVIAKDVHGVAWKFNF-VDGKSRRHYLTVGWKYFVRQKNLVPGDTVIFIR--D 250
                      77999899999887.********777*******99999*******************.8*******************************4..4 PP

                      SEE..EEEEE- CS
               B3  88 sefelvvkvfr 98 
                      ++ +l++++ r
  Ciclev10030751m 251 ENNKLRLGIKR 261
                      66767877765 PP

2Auxin_resp1033.6e-34287368182
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                      +a+a+s+ks+F+v+Y+Pra +seFv+ ++k++k+++++v++G +++m++e++dss +r+sG+v+g  dldp rWpnSkWr+L
  Ciclev10030751m 287 VADAISNKSTFDVFYSPRARHSEFVICYQKYMKSIRKPVCIGEKIQMQYEMDDSSGKRCSGVVIGACDLDPNRWPNSKWRCL 368
                      6899*****************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.104.1E-23153262IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019368.89E-18156259IPR015300DNA-binding pseudobarrel domain
CDDcd100173.96E-15159261No hitNo description
PfamPF023628.4E-14161261IPR003340B3 DNA binding domain
SMARTSM010192.9E-10161263IPR003340B3 DNA binding domain
PROSITE profilePS5086311.237202263IPR003340B3 DNA binding domain
PfamPF065077.2E-29288368IPR010525Auxin response factor
SuperFamilySSF520471.33E-15505770No hitNo description
Gene3DG3DSA:3.80.10.105.8E-4527611IPR032675Leucine-rich repeat domain, L domain-like
Gene3DG3DSA:3.80.10.105.8E-4647769IPR032675Leucine-rich repeat domain, L domain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 784 aa     Download sequence    Send to blast
METIDAPSET ETDDLNSTEI SDEDDCEGEI ETDDLIFTEI SDKDDDYNLL LWQAFAGPPP  60
SLPKKGDLVV YFPQGHLEYS APASVSKAPP TFDLKPEIIC RVADVRYLVS KKTDKVYTKM  120
TLLPLPEMVG ENFKGKELQD LVVDNKRDGE GSTANSTPPL FYKKLRASDQ SKKKIVIRAK  180
DAENVFPFLA HLDYKKQINY SVIAKDVHGV AWKFNFVDGK SRRHYLTVGW KYFVRQKNLV  240
PGDTVIFIRD ENNKLRLGIK RSIQAVNDVP GSIIQKHNTY LDVLSPVADA ISNKSTFDVF  300
YSPRARHSEF VICYQKYMKS IRKPVCIGEK IQMQYEMDDS SGKRCSGVVI GACDLDPNRW  360
PNSKWRCLLV RWEEYIGSNC EEMVSPWEID CSLSLPSMLH SSPRLKRPRT SLQDNLPAYS  420
TTGLEFPESS ITSEGEGTAS LINAIDLNRP FDLEPQAPVP KNFLALALFP DEDKILGIRT  480
GETLESLEID NLSSLASFLR SELAATTVKQ LKINKCPDLE VLLHRMAYTS LEYLEFSSCL  540
FFSNSKRDYF PTTLKRLKIC DCTNAELILK VLMDQKGLAL ESLEVDGCSS LFSLPINQLP  600
ATLRHLRIVN CMNLKSLGES SKIRNCDSVV GPEGESSLEN MTSSHTLELR ELEIWDCLEL  660
EFLPEDMHNF TDLNLLSISN CPSLESFPEG GLPNTSLTSL LISECENLMS LPHQIHKATS  720
LQDLSVSGCP SLMSFPHGGL PPNLISLGII DCENLIPLSQ WELHKLKHLN KYTILGGLPV  780
LEE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B7e-635139023353Auxin response factor 1
4ldw_A7e-635139023353Auxin response factor 1
4ldv_A7e-635139023353Auxin response factor 1
4ldy_B8e-635139023353Auxin response factor 1
4ldy_A8e-635139023353Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006438940.10.0hypothetical protein CICLE_v10030751mg
TrEMBLV4TKN70.0V4TKN7_9R
STRINGVIT_06s0004g03130.t011e-123(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.11e-117auxin response factor 4