PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10030696m
Common NameCICLE_v10030696mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family ARF
Protein Properties Length: 847aa    MW: 94479 Da    PI: 6.2992
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10030696mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.82.1e-23151252199
                      EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                      f+k+lt sd++++g +++ +++a+e+      +  ++ +++l  +d++g++W++++i+r++++r++l++GW+ Fv++++L +gD ++F   + +
  Ciclev10030696m 151 FCKTLTASDTSTHGGFSVLRRHADEClppldmS-RQPPTQELAAKDLHGNEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFL--RGE 241
                      99*****************************73.3334459************************************************..449 PP

                      EE..EEEEE-S CS
               B3  89 efelvvkvfrk 99 
                      ++el+v+v+r+
  Ciclev10030696m 242 NGELRVGVRRA 252
                      999*****996 PP

2Auxin_resp123.91.1e-40277359183
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                      a+ha+st+++F+v+Y+Pr+s+seF+v+++++++++k+++s+GmRfkm+fe+e+++e+r++Gt+vg++d+dp rW++SkWr+Lk
  Ciclev10030696m 277 AWHAVSTGTMFTVYYKPRTSPSEFIVPYDQYMESIKNNYSIGMRFKMRFEGEEAPEQRFTGTIVGIEDADPQRWRDSKWRCLK 359
                      89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.14E-40147280IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.9E-41148266IPR015300DNA-binding pseudobarrel domain
CDDcd100177.40E-21149251No hitNo description
PfamPF023622.5E-21151252IPR003340B3 DNA binding domain
PROSITE profilePS5086311.857151253IPR003340B3 DNA binding domain
SMARTSM010191.3E-22151253IPR003340B3 DNA binding domain
PfamPF065077.2E-38277359IPR010525Auxin response factor
PfamPF023091.2E-11702805IPR033389AUX/IAA domain
SuperFamilySSF542771.08E-11720798No hitNo description
PROSITE profilePS5174526.393721814IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009737Biological Processresponse to abscisic acid
GO:0009911Biological Processpositive regulation of flower development
GO:0010047Biological Processfruit dehiscence
GO:0010150Biological Processleaf senescence
GO:0010227Biological Processfloral organ abscission
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 847 aa     Download sequence    Send to blast
MAAAASSSEV SMKSCNETGR IPMEGQNSNS TTSGVKRVGD PEMALYTELW HACAGPLVTV  60
PREGERVYYF PQGHIEQVEA STNQVADQQM PVYDLPSKIL CRVINVQLKA EPDTDEVFAQ  120
VTLLPESNQD ENAVEKEPPP PPPPRFHVHS FCKTLTASDT STHGGFSVLR RHADECLPPL  180
DMSRQPPTQE LAAKDLHGNE WRFRHIFRGQ PRRHLLQSGW SVFVSSKRLV AGDAFIFLRG  240
ENGELRVGVR RAMRQQGNVP SSVISSHSMH LGVLATAWHA VSTGTMFTVY YKPRTSPSEF  300
IVPYDQYMES IKNNYSIGMR FKMRFEGEEA PEQRFTGTIV GIEDADPQRW RDSKWRCLKV  360
RWDETSTIPR PERVSPWKIE PALAPPALNS LPMPRPKRPR SNMLPSSPDS SVLTREGSSK  420
LNVDPSSATG FSRVLQGQEF STLRGNFAER ESNESDTAEK SVVWPPSLDD EKIDVVSASR  480
RYGSENWVPP GRHEPVYTDL LSGFGANADP SHGFSSPFAD AVPVRKSVLD QEGKFNLVAR  540
PWSLMPSGPS LKMPESNAKV PVQGGDVNYQ VRGNVRYGGF GDYPMLNGNR VEHSHGNWLM  600
PPLPPSNFEN SAHSRELMPK SAMVQDQEAG KSKDCKLFGI PLFSNHVMPE PVVSHRNTMN  660
DPAGNLDQQF RAFESDQKSD HSKSSKLADD NQVFNEHEKL SQPSQTHTKD VRSKTQCGST  720
RSCTKVQKQG IALGRSVDLS KFNNYDELIA ELDQLFEFDG ELMAPKKNWI IVYTDDEGDM  780
MLVGDDPWQE FCGMVRKIFI YTKEEVLKMN SVSFSSKGED SPMNGDGIDA KEVKQPLPLA  840
SNAENF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldx_B0.04438118354Auxin response factor 1
4ldx_A0.04438118354Auxin response factor 1
4ldw_B0.04438118354Auxin response factor 1
4ldw_A0.04438118354Auxin response factor 1
4ldv_A0.04438118354Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ccl.28190.0fruit
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00574DAPTransfer from AT5G62000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN6005200.0JN600520.1 Citrus sinensis auxin-response factor (ARF) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006436945.10.0hypothetical protein CICLE_v10030696mg
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLV4TF440.0V4TF44_9R
STRINGVIT_17s0000g00320.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53482647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2