PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10030232m
Common NameCICLE_v10030232mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family NF-YC
Protein Properties Length: 206aa    MW: 23028.8 Da    PI: 9.1033
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10030232mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC37.36e-121051871799
            NF-YC  17 knhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 
                      k  ++P+ rik+i+k++     i+ ea  l+ ka + f+ ++   ++  + + ++++l    +aa+v++  ++dfl d vp++
  Ciclev10030232m 105 KVCNFPMGRIKRIFKTQSSDIGITGEAVFLVNKATDKFLEQFCEDAYECCAKDRKKSLAYKHLAAVVSEQSKYDFLSDYVPEK 187
                      4679*************9999***********************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.21E-1561180IPR009072Histone-fold
PfamPF008082.6E-14109171IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.101.1E-21109186IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MASSKKRKEE KAKLENAETR KKAKPSPKKP KKSNKKTAIQ NGTVSESKDE VVVTPASSSI  60
NDSQQDSETE QEGRSQEQEA TNEKKKKPNK NGKKIERDDD DEVSKVCNFP MGRIKRIFKT  120
QSSDIGITGE AVFLVNKATD KFLEQFCEDA YECCAKDRKK SLAYKHLAAV VSEQSKYDFL  180
SDYVPEKIKA EDALAQRELA EGREG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12632PKKPKKS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ccl.224071e-31abscission zone
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006424600.11e-147hypothetical protein CICLE_v10030232mg
TrEMBLV4SG881e-147V4SG88_9R
STRINGPOPTR_0009s01750.14e-37(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM111902231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.13e-30nuclear factor Y, subunit C10