PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10029962m
Common NameCICLE_v10029962mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family LBD
Protein Properties Length: 170aa    MW: 18487.2 Da    PI: 7.3913
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10029962mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260144.82.5e-4561051100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +Ca+Ck+lrr+CakdCv+apyfp+++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql+ +l
  Ciclev10029962m   6 PCASCKLLRRRCAKDCVFAPYFPSDDPQKFAMVHKVFGASNVSKMLQELPVHQRADAVSSLVYEANARVRDPVYGCVGAISYLQNQVSQLQMQL 99 
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      a++++e
  Ciclev10029962m 100 AVAQAE 105
                      **9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.7955106IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-446103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MGGSSPCASC KLLRRRCAKD CVFAPYFPSD DPQKFAMVHK VFGASNVSKM LQELPVHQRA  60
DAVSSLVYEA NARVRDPVYG CVGAISYLQN QVSQLQMQLA VAQAEILCIQ MQQDPPAVSL  120
PTQIDHHQDH DRSLLLSCSN INPQLLAAGF ASSSSNAIQD PLKKESLWT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-5121227130LOB family transfactor Ramosa2.1
5ly0_B8e-5121227130LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed predominantly in roots, and at low levels in shoots, floral stems and open flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006425146.11e-122LOB domain-containing protein 12
SwissprotQ8LBW35e-78LBD12_ARATH; LOB domain-containing protein 12
TrEMBLV4SMT01e-121V4SMT0_9ROSI; Uncharacterized protein
STRINGXP_006425146.11e-122(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-80LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]