PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10029283m
Common NameCICLE_v10029283mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family LBD
Protein Properties Length: 210aa    MW: 22633.8 Da    PI: 7.6581
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10029283mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.69.2e-43451441100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r da+ss+vyeA ar+rdPvyG++g i +lq+q+++l+a+l
  Ciclev10029283m  45 PCAACKILRRRCADKCVLAPYFPPTEPAKFTIAHRVFGASNIIKFLQELPESQRADAVSSMVYEASARIRDPVYGCAGAICQLQKQVSELQAQL 138
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      a++++e
  Ciclev10029283m 139 AKAQAE 144
                      *99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.06844145IPR004883Lateral organ boundaries, LOB
PfamPF031955.3E-4345142IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MLKMENYEAA ATRNPSKVTS SRAGSSSPPP ISANSSAPPP VIMSPCAACK ILRRRCADKC  60
VLAPYFPPTE PAKFTIAHRV FGASNIIKFL QELPESQRAD AVSSMVYEAS ARIRDPVYGC  120
AGAICQLQKQ VSELQAQLAK AQAEVVSMQC QQANLVALLY KEMGKSPQPN SPQSVDHFIT  180
SPESPEANPC SFFEDNNLSG SLWEPALWT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-43401526118LOB family transfactor Ramosa2.1
5ly0_B7e-43401526118LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006424648.11e-153LOB domain-containing protein 1
SwissprotQ9SK083e-77LBD11_ARATH; LOB domain-containing protein 11
TrEMBLV4RTD11e-151V4RTD1_9ROSI; Uncharacterized protein
STRINGXP_006424648.11e-152(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.14e-72LOB domain-containing protein 11