PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10028882m
Common NameCICLE_v10028887mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family BBR-BPC
Protein Properties Length: 312aa    MW: 34785.5 Da    PI: 9.796
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10028882mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind338.31.9e-10313111301
        GAGA_bind   1 mdddgsre.rnkg.yye................paaslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalve 76 
                      mdd  +++ r k  yy+                p+++l   +++++m+++aerda+irern+al+ek++a+ +rd a+ +rdkalaer++al+ 
  Ciclev10028882m   1 MDDGHHENgRYKMeYYKgthaqwnmmpqhqmkePNNALV--MNKKIMAILAERDAAIRERNIALTEKREALETRDQALEERDKALAERDDALMA 92 
                      88888888999988999********98766643335555..99*************************************************** PP

        GAGA_bind  77 rdnkllalllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkek.kakkkkk 169
                      rd++l+al+++e ++++++    +  +g k +++     ++   ++a +  +++ ++a+pi+  ++e+k ++ k+++++++++k +   +k+kk
  Ciclev10028882m  93 RDSALAALQYREAAANFSS--VGGFQRGGKRMHHPAY--QSGDVPEALNSGDMHATDAKPITIIPSETKPHQAKRAKENKTVTKPSvSPRKVKK 182
                      **********999977655..5677899999998887..3444566677899********9987777765554444444444443314568899 PP

        GAGA_bind 170 ksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqg 263
                       +e+ +kkv++++  ++ k+e++s+d +ln v++De+t+PvPvC+CtG+++qCYkWGnGGWqS+CCttt+S yPLP+++++r+aR++grKmS++
  Ciclev10028882m 183 VGEDLNKKVASDG--KKIKSEWDSQD-GLNLVNFDETTMPVPVCTCTGTPHQCYKWGNGGWQSSCCTTTLSSYPLPQMPNKRHARVGGRKMSGS 273
                      9999999999999..57*********.9****************************************************************** PP

        GAGA_bind 264 afkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                      +f+klL++LaaeG+dls p+DLk++WAkHGtn+++ti+
  Ciclev10028882m 274 VFTKLLSRLAAEGHDLSVPLDLKNFWAKHGTNRYITIK 311
                      *************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062173.6E-971311IPR010409GAGA-binding transcriptional activator
SMARTSM012269.4E-1501311IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MDDGHHENGR YKMEYYKGTH AQWNMMPQHQ MKEPNNALVM NKKIMAILAE RDAAIRERNI  60
ALTEKREALE TRDQALEERD KALAERDDAL MARDSALAAL QYREAAANFS SVGGFQRGGK  120
RMHHPAYQSG DVPEALNSGD MHATDAKPIT IIPSETKPHQ AKRAKENKTV TKPSVSPRKV  180
KKVGEDLNKK VASDGKKIKS EWDSQDGLNL VNFDETTMPV PVCTCTGTPH QCYKWGNGGW  240
QSSCCTTTLS SYPLPQMPNK RHARVGGRKM SGSVFTKLLS RLAAEGHDLS VPLDLKNFWA  300
KHGTNRYITI K*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006423509.10.0hypothetical protein CICLE_v10028887mg
RefseqXP_006423510.10.0hypothetical protein CICLE_v10028887mg
RefseqXP_006423511.10.0hypothetical protein CICLE_v10028887mg
SwissprotQ8S8C61e-134BPC4_ARATH; Protein BASIC PENTACYSTEINE4
TrEMBLV4UBU40.0V4UBU4_9R
STRINGPOPTR_0009s12820.11e-162(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40902659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21240.21e-126basic pentacysteine 4