PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10027918m
Common NameCICLE_v10027839mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family ARF
Protein Properties Length: 711aa    MW: 78939.9 Da    PI: 8.5056
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10027918mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B375.84.8e-24172273199
                      EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                      f+k+lt sd++++g +++p++ ae++      + +++ s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv++++L +gD v+F   + +
  Ciclev10027918m 172 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyK-QQRPSQELVAKDLHGVEWRFRHIYRGQPRRHLLTTGWSIFVSQKNLVSGDAVLFL--RGK 262
                      99****************************963.3445679************************************************..449 PP

                      EE..EEEEE-S CS
               B3  89 efelvvkvfrk 99 
                      ++el+++++r+
  Ciclev10027918m 263 DGELRLGIRRS 273
                      9999****996 PP

2Auxin_resp121.37.1e-40298379182
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                      +a+a+stks+F+v+Y+Pra++++Fv++++k++k + +++++G+Rfkm+fe++ds+err+ G+v+g++dldp+rWpnSkWr+L
  Ciclev10027918m 298 VANAVSTKSMFHVFYSPRATHADFVIPYQKYVKIIMNPICIGTRFKMRFEMDDSPERRCNGVVTGITDLDPYRWPNSKWRCL 379
                      689******************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019368.76E-44164287IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.5E-40165283IPR015300DNA-binding pseudobarrel domain
CDDcd100177.30E-23170272No hitNo description
SMARTSM010191.0E-23172274IPR003340B3 DNA binding domain
PfamPF023624.1E-22172273IPR003340B3 DNA binding domain
PROSITE profilePS5086312.999172274IPR003340B3 DNA binding domain
PfamPF065071.4E-33298379IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 711 aa     Download sequence    Send to blast
MEFDLNHAAT TEGEKIAFCN GDCGKNNSGC VCYLNSSSSS SSCSANSSSS SSLYSSIYFE  60
LWHACAGPLT SLPKKGNVVV YFPQGHLEQV ASSSAFPPIE VPNFDLQPQI FCKVVDVQLL  120
ANKENDEVYT QVALLPQPEL EGLNLEAKQL ENLGVDEEGG GRSPTKSTPH MFCKTLTASD  180
TSTHGGFSVP RRAAEDCFPP LDYKQQRPSQ ELVAKDLHGV EWRFRHIYRG QPRRHLLTTG  240
WSIFVSQKNL VSGDAVLFLR GKDGELRLGI RRSVQPRNGL PDSILSKQNS YPNVLSVVAN  300
AVSTKSMFHV FYSPRATHAD FVIPYQKYVK IIMNPICIGT RFKMRFEMDD SPERRCNGVV  360
TGITDLDPYR WPNSKWRCLM VRWDECIGSD HQEQVSPWEI DRSVSLPPLS IQSSPRMKKL  420
RTGLQAPPPD YPVSARGGGV LDFEESVRSS KVLQGQENVG FVSPLCGCDT VNHPLGFEMR  480
APAHQSLALN GIRKDNINEL VRARPTSYTG FVESNRFPKV LQGQEICPLR SLTGKVDLNL  540
GTWGKPNFGC NSMNMYQASK PNIYPPPSES LSNMFFPYGD MPKTVQHHTM RPYASNLQRE  600
NVKLNSSSIQ MPAIGAEIRK ENLLNEHKPV ENIPTPTFKA NMTSHKDGSF NGTAAGCKLF  660
GFSLTSETPT PSSQSPGKRS CTKVSYVRIK IGKNLPIFNF CLFLLLMMFH *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1175340115353Auxin response factor 1
4ldw_A1e-1175340115353Auxin response factor 1
4ldw_B1e-1175340115353Auxin response factor 1
4ldx_A1e-1175340115353Auxin response factor 1
4ldx_B1e-1175340115353Auxin response factor 1
4ldy_A1e-1175340115353Auxin response factor 1
4ldy_B1e-1175340115353Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ccl.213530.0fruit
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006424618.10.0hypothetical protein CICLE_v10027839mg
SwissprotQ9ZTX90.0ARFD_ARATH; Auxin response factor 4
TrEMBLV4RTA90.0V4RTA9_9R
STRINGVIT_06s0004g03130.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.10.0auxin response factor 4