PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10027275m
Common NameCICLE_v10027275mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family LBD
Protein Properties Length: 297aa    MW: 32658.8 Da    PI: 7.4129
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10027275mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.26e-4371061100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv kll++l ++ reda++sl+yeAear+rdPvyG+vg+i+ lq++l+q++++l
  Ciclev10027275m   7 PCAACKFLRRKCTQECVFAPYFPPDQPQKFANVHKVFGASNVAKLLNELATNLREDAVNSLAYEAEARLRDPVYGCVGLISILQHRLKQVQSDL 100
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                       ++k+e
  Ciclev10027275m 101 YSAKKE 106
                      999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.366107IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-427104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MSSSNSPCAA CKFLRRKCTQ ECVFAPYFPP DQPQKFANVH KVFGASNVAK LLNELATNLR  60
EDAVNSLAYE AEARLRDPVY GCVGLISILQ HRLKQVQSDL YSAKKELATY IGPQAMMPML  120
QAQAFMPQQH LGNPSSSTVI QHGMVPMMGI PTGSSHSGQL VIRDPQHQHQ HNQQQQQMFE  180
AQQLAAAVAA KEQQEMLRSY EQQQELVRFN SGFDAPTGFN NQMSGGTMSP SLALGGFDNS  240
YQIQAQQQPA EHHHHHATAH PLQAQLLQQQ PPPPPQTQQQ QKSPSEEGRS IGGPSC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-4941108114LOB family transfactor Ramosa2.1
5ly0_B3e-4941108114LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in trichomes, at the base of many lateral organs, including branching points of the inflorescence and floral organs and in the distal part of the pistil at stages when style and stigma start to develop. Also detected in pedicels and at the base of petals and sepals. {ECO:0000269|PubMed:15821980}.
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015389383.10.0LOB domain-containing protein 36
SwissprotQ9FKZ39e-90LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A067DDH10.0A0A067DDH1_CITSI; Uncharacterized protein
TrEMBLV4UIA80.0V4UIA8_9ROSI; Uncharacterized protein
STRINGXP_006466646.10.0(Citrus sinensis)
STRINGXP_006425834.10.0(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM80082441
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.15e-86ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]