PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10027242m
Common NameCICLE_v10027242mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family CPP
Protein Properties Length: 776aa    MW: 86091.2 Da    PI: 5.2839
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10027242mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR52.59.5e-17543581139
              TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                      ++k+gCnCkkskClkkYCeCf+a++ Cs+ C+Ce+C+N+
  Ciclev10027242m 543 RHKRGCNCKKSKCLKKYCECFQANVGCSDGCRCEGCSNS 581
                      589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5163424.704459583IPR005172CRC domain
SMARTSM011141.1E-17543584IPR033467Tesmin/TSO1-like CXC domain
PfamPF036384.6E-12545581IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 776 aa     Download sequence    Send to blast
MESPEGDRIK ATSLSTPGSS PAVQESPVFN FISNLSPINS VKAARYTQRF FETQFPTPPP  60
VFRTPRLDLQ RETSFLKSND ADAASRDYGD CGNRMSTVLV PCMQKELQSC SPSGCVDDYL  120
TDPVEVEGCS NSNELCVQPA KNVSKLSSSG FNSPTITSPK VNGANDRNSE DFMHMLPDQA  180
EQDPLRSLAL FETAIEQRDA ESFDGSHKLT PTEKADQNVM LQNTGTQHNG QDGRSQSPKN  240
LQNVEADKNS SENVGPVSTG LLKSRSRIIH RRIIEYDSKI SHSSHNVTQE SDNSTLPASF  300
RDWESLIPSD IEPREVSSGR EATSSSQNVA SRLSFCQSDF VRSSQNEESL PLIGPLPPGF  360
SLHLSSMAEL MPISSDLMPT GRIHDYMKND QLDDQAVVGA SLVISQYTDS MKQISDSLQM  420
TLSEQQAAPC EGMMLTSEIE ELNQVNKSII SDGEIFRVQH DLIEAFFSSF NVDPVSNAGI  480
YCIDSCACES CFNKPEYEET VTDTRQQIQS RNPLAFAPKI VGHADSAANV VEDGNLTTPA  540
SARHKRGCNC KKSKCLKKYC ECFQANVGCS DGCRCEGCSN SFGRKTESKY QKVQRWENQS  600
HVKLDAAANV TDSTKTRTIK PFSARWEDLP DMSHLTPLSY SYPEAEASSV SPSMRDFQNV  660
RRTHLHHESS FQSVNPHWQS PMSSMPQFHE DFAEHNRRSS YSKVHDTTKE DNMPEIQKDT  720
STPSNASKAD VPNRKQISPP QFQSQELRSS STQGGLESDR KFSWKNVPSF PPLTPY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006427190.10.0hypothetical protein CICLE_v10027242mg, partial
TrEMBLV4SNE40.0V4SNE4_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15696813
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.13e-49Tesmin/TSO1-like CXC domain-containing protein